Sunday, Jun 16, 2019 12:16:32
Level II Radar
Feed Latency
Feed Latency
TDS-Delta0.985 s
RDS-Delta0.894 s
TDS-Echo0.986 s
RDS-Echo0.908 s
Delta0.924 s
Echo0.905 s
Unavailable Sites
Site Age
RKJK3,499 min
KPUX424 min
KGRK14 min

Level III Radar
Feed Latency
Feed Latency
Delta-Ingest01.583 s
Delta-Ingest10.761 s
Echo-IngestA1.035 s
Echo-IngestB0.823 s
Delta1.036 s
Echo0.776 s
Unavailable Sites
Site Age
KJK3,499 min
GRK227 min
PUX68 min

Canadian Radar
Feed Latency
Feed Latency
Delta-Ingest00.556 s
Delta-Ingest10.543 s
Delta-Ingest20.539 s
Echo-IngestA0.534 s
Echo-IngestB0.538 s
Echo-IngestC0.533 s
Delta0.537 s
Echo0.540 s
Unavailable Sites
Site Age
WGJ57,783 min
WSO27,721 min

Conduit/NCEP IDD
Feed Latency
Feed Latency
Delta-Ingest027.614 s
Delta-Ingest1210.222 s
Echo-IngestA1,109.139 s
Echo-IngestB198.714 s
Delta20.388 s
Echo254.390 s
Data Age
Type Age
NAM152 min
FNEXRAD1 min
NDFD0 min
GENS0 min
HRRR0 min
VX-HRRR0 min
RUC0 min
GFS0 min

Additional Resources
NWS Administrative Messages
NWS Administrative Alerts
NWS Level II Status
NWS Level III Status
Environment Canada Radar Status
Internet2 Backbone Monitor
Detailed Statistics
Level 2 Latency Logs
Level 2 Status Map

NWS Administrative Alerts
These texts are presented as received.

Return

935 
NOUS74 KMRX 161150
ADAMRX

Routine Administrative Message (Urgent Notification)
National Weather Service Morristown TN 
800 AM EDT Sun Jun 16 2019

TO: MEG (Public Service)

FM: MRX

Morristown Morning Climate Data

Yesterday's Max        83

12 Hour Min            64

24 Hour Pcpn         0.00

24 Hour Snowfall      0.0

Snow on the Ground      0

$$



 005 NOUS74 KMRX 151202 ADAMRX Routine Administrative Message (Urgent Notification) National Weather Service Morristown TN 800 AM EDT Sat Jun 15 2019 TO: MEG (Public Service) FM: MRX Morristown Morning Climate Data Yesterday's Max 76 12 Hour Min 57 24 Hour Pcpn 0.00 24 Hour Snowfall 0.0 Snow on the Ground 0 $$ 
 858 NOUS71 KNES 151055 ADANES SUBJECT: PRODUCT OUTAGE/ANOMALY: DMSP SSMI/S DATA LOST - ISSUED: THIS IS A MULTI-PART MESSAGE IN MIME FORMAT. --BOUNDARY_(ID_MM7JPJFGJOEFHFBNKKB85Q) CONTENT-TYPE: TEXT/PLAIN; CHARSET=UTF-8; FORMAT=FLOWED CONTENT-TRANSFER-ENCODING: 7BIT *TOPIC:*DMSP SSMI/S DATA LOST. ** *DATE/TIME ISSUED: *JUNE 15, 2019 1050Z ** *PRODUCT(S) OR DATA IMPACTED:*F-16 REV 80788. *DATE/TIME OF INITIAL IMPACT: *JUNE 15, 2019 0807Z *DATE/TIME OF EXPECTED END: *TBD ** *LENGTH OF OUTAGE:*TBD *DETAILS/SPECIFICS OF CHANGE:*ESPC DID NOT RECEIVE DMSP SSMI/S F-16 REV 80788. ESPC CALLED MONTEREY/FNMOC AND REQUESTED A RESHIP OF THE DATA.AFTER THE RESHIP F-16 REV. 80788 WAS NOT RECEIVED AT ESPC. THE DATA IS CONSIDERED LOST. *CONTACT INFORMATION FOR FURTHER INFORMATION:* ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AT 301-817-3880 ** *WEB SITE(S) FOR APPLICABLE INFORMATION:*N/A THIS MESSAGE WAS SENT BY ESPC.NOTIFICATION@NOAA.GOV . YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880 . PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST. _ --BOUNDARY_(ID_MM7JPJFGJOEFHFBNKKB85Q) CONTENT-TYPE: TEXT/HTML; CHARSET=UTF-8 CONTENT-TRANSFER-ENCODING: 8BIT TOPIC: DMSP SSMI/S DATA LOST.


DATE/TIME ISSUED: JUNE 15, 2019 1050Z


PRODUCT(S) OR DATA IMPACTED: F-16 REV 80788.

DATE/TIME OF INITIAL IMPACT: JUNE 15, 2019 0807Z

DATE/TIME OF EXPECTED END: TBD

LENGTH OF OUTAGE: TBD

DETAILS/SPECIFICS OF CHANGE: ESPC DID NOT RECEIVE DMSP SSMI/S F-16 REV 80788. ESPC CALLED MONTEREY/FNMOC AND REQUESTED A RESHIP OF THE DATA. AFTER THE RESHIP F-16 REV. 80788 WAS
NOT RECEIVED AT ESPC. THE DATA IS CONSIDERED LOST.


CONTACT INFORMATION FOR FURTHER INFORMATION: ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AT 301-817-3880


WEB SITE(S) FOR APPLICABLE INFORMATION: N/A

THIS MESSAGE WAS SENT BY ESPC.NOTIFICATION@NOAA.GOV. YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880. PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST.

--BOUNDARY_(ID_MM7JPJFGJOEFHFBNKKB85Q)-- = 
 940 NOUS71 KNES 141555 ADANES SUBJECT: PRODUCT OUTAGE/ANOMALY: N-19 REV 53330 AND REV 53331 DATA THIS IS A MULTI-PART MESSAGE IN MIME FORMAT. --BOUNDARY_(ID_W/NEVCL9I+ICHVKNUZWQ6Q) CONTENT-TYPE: TEXT/PLAIN; CHARSET=UTF-8; FORMAT=FLOWED CONTENT-TRANSFER-ENCODING: 8BIT *TOPIC:*N-19 REV 53330 AND REV 53331 DATA LOST *DATE/TIME ISSUED: *JUNE 14, 2019 1550Z *PRODUCT(S) OR DATA IMPACTED: *N-19 REV. 53330 (GAC 4A, LAC 1A, LAC 1B - LAC 4B), N-19 REV. 53331 ( GAC 5A, LAC 2A,LAC 4A AND LAC 5B) *DATE/TIME OF INITIAL IMPACT: *JUNE 14, 2019 0938Z *DATE/TIME OF EXPECTED END: *JUNE 14, 2019 1129Z ** *LENGTH OF OUTAGE:* APPROXIMATELY 2 HOURS *DETAILS/SPECIFICS OF CHANGE:*ESPC DID NOT RECEIVE N-19 REV 53330 AND REV 53331. THE POES CONTROLLER REPORTS THAT THE NOAA 19 STORED COMMAND TABLE ON THE SPACECRAFT THAT EXECUTES RECORD AND PLAYBACK COMMANDS WAS NOT RUNNING PROPERLY CAUSING DATA FROM REVS 53330 AND 53331 TO NOT BE RECORDED AND/OR PLAYED DOWN. A NEW STORED COMMAND TABLE WAS LOADED UP TO THE SPACECRAFT AT APPROXIMATELY 1110Z AND IS FUNCTIONING PROPERLY SO FROM THIS POINT FORWARD, ALL DATA SETS SHOULD BE RECORDED AND PLAYED DOWN NOMINALLY. . DATA IS CONSIDERED LOST. *CONTACT INFORMATION FOR FURTHER INFORMATION:* ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AT 301-817-3880 *WEB SITE(S) FOR APPLICABLE INFORMATION:*N/A THIS MESSAGE WAS SENT BY ESPC.NOTIFICATION@NOAA.GOV . YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880 . PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST. _ --BOUNDARY_(ID_W/NEVCL9I+ICHVKNUZWQ6Q) CONTENT-TYPE: TEXT/HTML; CHARSET=UTF-8 CONTENT-TRANSFER-ENCODING: 8BIT

TOPIC: N-19 REV 53330 AND REV 53331 DATA LOST

DATE/TIME ISSUED: JUNE 14, 2019 1550Z

PRODUCT(S) OR DATA IMPACTED: N-19 REV. 53330 (GAC 4A, LAC 1A, LAC 1B - LAC 4B), N-19 REV. 53331 ( GAC 5A, LAC 2A, LAC 4A AND LAC 5B)

DATE/TIME OF INITIAL IMPACT: JUNE 14, 2019 0938Z

DATE/TIME OF EXPECTED END: JUNE 14, 2019 1129Z

LENGTH OF OUTAGE: APPROXIMATELY 2 HOURS

DETAILS/SPECIFICS OF CHANGE: ESPC DID NOT RECEIVE N-19 REV 53330 AND REV 53331. THE POES CONTROLLER REPORTS THAT THE NOAA 19 STORED COMMAND TABLE ON THE SPACECRAFT THAT EXECUTES RECORD AND PLAYBACK COMMANDS WAS NOT RUNNING PROPERLY CAUSING DATA FROM REVS 53330 AND 53331 TO NOT BE RECORDED AND/OR PLAYED DOWN. A NEW STORED COMMAND TABLE WAS LOADED UP TO THE SPACECRAFT AT APPROXIMATELY 1110Z AND IS FUNCTIONING PROPERLY SO FROM THIS POINT FORWARD, ALL DATA SETS SHOULD BE RECORDED AND PLAYED DOWN NOMINALLY. . DATA IS CONSIDERED LOST.

CONTACT INFORMATION FOR FURTHER INFORMATION: ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AT 301-817-3880

WEB SITE(S) FOR APPLICABLE INFORMATION: N/A

THIS MESSAGE WAS SENT BY ESPC.NOTIFICATION@NOAA.GOV. YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880. PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST.

--BOUNDARY_(ID_W/NEVCL9I+ICHVKNUZWQ6Q)-- = 
 210 NOUS71 KNES 140809 ADANES SUBJECT: PRODUCT OUTAGE/ANOMALY: N-19 GAC SV DATA LOST - ISSUED: THIS IS A MULTI-PART MESSAGE IN MIME FORMAT. --BOUNDARY_(ID_HD2C2VQ8IDHIBEQ/1TX7GG) CONTENT-TYPE: TEXT/PLAIN; CHARSET=UTF-8; FORMAT=FLOWED CONTENT-TRANSFER-ENCODING: 8BIT *TOPIC:*N-19 GAC SV DATA LOST *DATE/TIME ISSUED: *JUNE 14, 2019 0801Z *PRODUCT(S) OR DATA IMPACTED: *N-19 GAC 2A SV REV.53328 *DATE/TIME OF INITIAL IMPACT: *JUNE 14, 2019 0550Z *DATE/TIME OF EXPECTED END: *N/A ** *LENGTH OF OUTAGE:* N/A *DETAILS/SPECIFICS OF CHANGE:*ESPC REPORTS THAT THE N-19 GAC SV DID NOT LOCK UP DUR TO ANTENNA PROBLEM REPORTED BY THE POES CONTROLLER . DATA IS CONSIDERED LOST. *CONTACT INFORMATION FOR FURTHER INFORMATION:* ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AT 301-817-3880 *WEB SITE(S) FOR APPLICABLE INFORMATION:*N/A THIS MESSAGE WAS SENT BY ESPC.NOTIFICATION@NOAA.GOV . YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880 . PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST. _ --BOUNDARY_(ID_HD2C2VQ8IDHIBEQ/1TX7GG) CONTENT-TYPE: TEXT/HTML; CHARSET=UTF-8 CONTENT-TRANSFER-ENCODING: 8BIT

TOPIC: N-19 GAC SV DATA LOST

DATE/TIME ISSUED: JUNE 14, 2019 0801Z

PRODUCT(S) OR DATA IMPACTED: N-19 GAC 2A SV REV.53328

DATE/TIME OF INITIAL IMPACT: JUNE 14, 2019 0550Z

DATE/TIME OF EXPECTED END: N/A

LENGTH OF OUTAGE: N/A

DETAILS/SPECIFICS OF CHANGE: ESPC REPORTS THAT THE N-19 GAC SV DID NOT LOCK UP DUR TO ANTENNA PROBLEM REPORTED BY THE POES CONTROLLER . DATA IS CONSIDERED LOST.

CONTACT INFORMATION FOR FURTHER INFORMATION: ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AT 301-817-3880

WEB SITE(S) FOR APPLICABLE INFORMATION: N/A

THIS MESSAGE WAS SENT BY ESPC.NOTIFICATION@NOAA.GOV. YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880. PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST.

--BOUNDARY_(ID_HD2C2VQ8IDHIBEQ/1TX7GG)-- = 
 404 NOUS71 KNES 132104 ADANES SUBJECT: PRODUCT OUTAGE: UPDATE #1: GOES-16, THIS IS A MULTI-PART MESSAGE IN MIME FORMAT. --BOUNDARY_(ID_QT3F+CBKKM4TKXWASA7VDA) CONTENT-TYPE: TEXT/PLAIN; CHARSET=UTF-8; FORMAT=FLOWED CONTENT-TRANSFER-ENCODING: 8BIT *UPDATE #1: *THE TIMES OF THE DMW OUTAGES AT NSOF WERE: G16 FD FROM: 163/1500 UNTIL: 164/1800 CONUS FROM: 163/1546 UNTIL: 164/1746 MESO1 FROM: 163/1545 UNTIL: 164/1745 MESO2 FROM: 163/1545 UNTIL: 164/1745 G17 FD FROM: 163/1500 UNTIL: 164/1600 CONUS FROM: 163/1546 UNTIL: 164/1601 MESO1 FROM: 163/1545 UNTIL: 164/1535 MESO2 FROM: 163/1545 UNTIL: 164/1535 *TOPIC*: GOES-16, GOES-17 ABI L2 DERIVED MOTION WINDS ALL CHANNELS DELIVERED TO PDA *DATE/TIME ISSUED*: JUNE 13, 2019 2100Z *PRODUCT(S) OR DATA IMPACTED*: GOES-16, GOES-17 ABI L2 DERIVED MOTION WINDS ALL CHANNELS ALL SCENE TYPES DELIVERED TO PDA *DATE/TIME OF INITIAL IMPACT:* JUNE 12, 2019 1552Z *DATE/TIME OF EXPECTED END*: JUNE 13, 2019 1800Z *LENGTH OF EVENT:* APPROXIMATELY 26 HOURS *DETAILS/SPECIFICS OF CHANGE*: GOES-16, GOES-17 ABI L2 DERIVED MOTION WINDS ALL CHANNELS ALL SCENE TYPES DELIVERED TO PDA *CONTACT INFORMATION FOR FURTHER INFORMATION: * ESPCOPERATIONS@NOAA.GOV ROSS.COX@NOAA.GOV *WEB SITE(S) FOR APPLICABLE INFORMATION:* N/A THIS MESSAGE WAS SENT FROM ESPC.NOTIFICATION@NOAA.GOV . YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880 . PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST. --BOUNDARY_(ID_QT3F+CBKKM4TKXWASA7VDA) CONTENT-TYPE: TEXT/HTML; CHARSET=UTF-8 CONTENT-TRANSFER-ENCODING: 8BIT

UPDATE #1: THE TIMES OF THE DMW OUTAGES AT NSOF WERE:

G16 FD FROM: 163/1500 UNTIL: 164/1800

CONUS FROM: 163/1546 UNTIL: 164/1746

MESO1 FROM: 163/1545 UNTIL: 164/1745

MESO2 FROM: 163/1545 UNTIL: 164/1745

G17 FD FROM: 163/1500 UNTIL: 164/1600

CONUS FROM: 163/1546 UNTIL: 164/1601

MESO1 FROM: 163/1545 UNTIL: 164/1535

MESO2 FROM: 163/1545 UNTIL: 164/1535


TOPIC: GOES-16, GOES-17 ABI L2 DERIVED MOTION WINDS ALL CHANNELS DELIVERED TO PDA

DATE/TIME ISSUED: JUNE 13, 2019 2100Z

PRODUCT(S) OR DATA IMPACTED: GOES-16, GOES-17 ABI L2 DERIVED MOTION WINDS ALL CHANNELS ALL SCENE TYPES DELIVERED TO PDA

DATE/TIME OF INITIAL IMPACT: JUNE 12, 2019 1552Z

DATE/TIME OF EXPECTED END:
JUNE 13, 2019 1800Z

LENGTH OF EVENT: APPROXIMATELY 26 HOURS

DETAILS/SPECIFICS OF CHANGE: GOES-16, GOES-17 ABI L2 DERIVED MOTION WINDS ALL CHANNELS ALL SCENE TYPES DELIVERED TO PDA

CONTACT INFORMATION FOR FURTHER INFORMATION:
ESPCOPERATIONS@NOAA.GOV
ROSS.COX@NOAA.GOV

WEB SITE(S) FOR APPLICABLE INFORMATION: N/A


THIS MESSAGE WAS SENT FROM ESPC.NOTIFICATION@NOAA.GOV. YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880. PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST.

--BOUNDARY_(ID_QT3F+CBKKM4TKXWASA7VDA)-- =  013 NOUS71 KNES 132155 ADANES SUBJECT: PRODUCT OUTAGE/ANOMALY: COSMIC DATA OUTAGE - ISSUED: JUNE 13, THIS IS A MULTI-PART MESSAGE IN MIME FORMAT. --BOUNDARY_(ID_FQJXGIS7UYX/GAS7NSQWLQ) CONTENT-TYPE: TEXT/PLAIN; CHARSET=WINDOWS-1252; FORMAT=FLOWED CONTENT-TRANSFER-ENCODING: 8BIT *TOPIC:* **COSMIC DATA OUTAGE *DATE/TIME ISSUED**:*JUNE 13, 2019 2150Z *PRODUCT(S) OR DATA IMPACTED*: COSMIC DATA *DATE/TIME OF INITIAL IMPACT*:JUNE 13, 2019 APPROX. 2100Z *DATE/TIME OF EXPECTED END**: *TBD *LENGTH OF EVENT: *TBD *DETAILS/SPECIFICS OF CHANGE:*ESPC IS NOT RECEIVING COSMIC DATA. THE OUTAGE IS DUE TO THE COSMIC-1 SATELLITE'S STATE OF HEALTH. *CONTACT INFORMATION FOR FURTHER INFORMATION:* ESPCOPERATIONS@NOAA.GOV AND 301-817-3880 *WEB SITE(S) FOR APPLICABLE INFORMATION:*N/A THIS MESSAGE WAS SENT FROM ESPC.NOTIFICATION@NOAA.GOV . YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880 . PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST. --BOUNDARY_(ID_FQJXGIS7UYX/GAS7NSQWLQ) CONTENT-TYPE: TEXT/HTML; CHARSET=WINDOWS-1252 CONTENT-TRANSFER-ENCODING: 8BIT
TOPIC: COSMIC DATA OUTAGE

DATE/TIME ISSUED: JUNE 13, 2019 2150Z

PRODUCT(S) OR DATA IMPACTED: COSMIC DATA

DATE/TIME OF INITIAL IMPACT: JUNE 13, 2019 APPROX. 2100Z

DATE/TIME OF EXPECTED END: TBD

LENGTH OF EVENT: TBD

DETAILS/SPECIFICS OF CHANGE: ESPC IS NOT RECEIVING COSMIC DATA. THE OUTAGE IS DUE TO THE COSMIC-1 SATELLITE'S STATE OF HEALTH.

CONTACT INFORMATION FOR FURTHER INFORMATION: HREF="MAILTO:ESPCOPERATIONS@NOAA.GOV" TARGET="_BLANK" MOZ-DO-NOT-SEND="TRUE">ESPCOPERATIONS@NOAA.GOV AND 301-817-3880

WEB SITE(S) FOR APPLICABLE INFORMATION: N/A

THIS MESSAGE WAS SENT FROM ESPC.NOTIFICATION@NOAA.GOV. YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880. PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST.

--BOUNDARY_(ID_FQJXGIS7UYX/GAS7NSQWLQ)-- = 
 637 NOUS71 KNES 132044 ADANES SUBJECT: PRODUCT ANOMALY (UPDATE #1): INTERMITTENT DEGRADATION THIS IS A MULTI-PART MESSAGE IN MIME FORMAT. --BOUNDARY_(ID_FFJDLBDJJLR70ZRT0OWAGW) CONTENT-TYPE: TEXT/PLAIN; CHARSET=UTF-8; FORMAT=FLOWED CONTENT-TRANSFER-ENCODING: 8BIT *UPDATE #1:* THE INTERMITTENT DEGRADATION OF GOES-16 MESO-2 SOUNDING PRODUCTS WAS RESOLVED ON JUNE 13, 2019 AT 1459Z. * * *TOPIC: *PRODUCT ANOMALY: INTERMITTENT DEGRADATION OF GOES-16 MESO-2 SOUNDING PRODUCTS AND THEIR DISTRIBUTION TO PDA. *DATE/TIME ISSUED:* JUNE13, 2019 2042Z *PRODUCT(S) OR DATA IMPACTED: * INTERMITTENT DEGRADATION OF GOES-16 MESO-2 SOUNDING PRODUCTS (LEGACY VERTICAL TEMPERATURE, LEGACY VERTICAL MOISTURE, TOTAL PRECIPITABLE WATER) AND THEIR DISTRIBUTION TO PDA. *DATE/TIME OF INITIAL IMPACT: * JUNE 12, 2019 2115Z *DATE/TIME OF EXPECTED END:* JUNE 13, 2019 1459Z *LENGTH OF EVENT:* 17 HOURS, 44 MINUTES *DETAILS/SPECIFICS OF CHANGE:* INTERMITTENT DEGRADATION OF GOES-16 MESO-2 SOUNDING PRODUCTS (LEGACY VERTICAL TEMPERATURE, LEGACY VERTICAL MOISTURE, TOTAL PRECIPITABLE WATER) AND THEIR DISTRIBUTION TO PDA DUE TO AN ANOMALY. ** ** *CONTACT INFORMATION FOR FURTHER INFORMATION: *ROSS.COX@NOAA.GOV *WEB SITE(S) FOR APPLICABLE INFORMATION:*N/A THIS MESSAGE WAS SENT FROM ESPC.NOTIFICATION@NOAA.GOV . YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880 . PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST. --BOUNDARY_(ID_FFJDLBDJJLR70ZRT0OWAGW) CONTENT-TYPE: TEXT/HTML; CHARSET=UTF-8 CONTENT-TRANSFER-ENCODING: BASE64 PGH0BWW+DQOGIDXOZWFKPG0KICAGIDXTZXRHIGH0DHATZXF1AXY9IMNVBNRLBNQTDHLWZSIG Y29UDGVUDD0IDGV4DC9ODG1SOYBJAGFYC2V0PVVURI04IJ4NCIAGPC9OZWFKPG0KICA8YM9K ESB0ZXH0PSIJMDAWMDAWIIBIZ2NVBG9YPSIJRKZGRKZGIJ4NCIAGICA8ZGL2IGRPCJ0IBHRY IJ4NCIAGICAGIDXKAXYGZGLYPSJSDHIIPG0KICAGICAGICA8ZGL2DQPZDHLSZT0IDGV4DC1H BGLNBJPSZWZ0O2NVBG9YONJNYIGZNCWZNCWZNCK7DGV4DC10CMFUC2ZVCM06BM9UZTTSAW5L LWHLAWDODDOXOS45OXB4O3RLEHQTAW5KZW50OJBWEDTSZXR0ZXITC3BHY2LUZZPUB3JTYWW7 B3ZLCMZSB3C6DMLZAWJSZTTMB250LXNPEMU6MTMUMZNWEDTMB250LXN0EWXLOM5VCM1HBDTM B250LXZHCMLHBNQ6BM9YBWFSO3RLEHQTZGVJB3JHDGLVBJPUB25LO3DVCMQTC3BHY2LUZZOW CHG7D2HPDGUTC3BHY2U6BM9YBWFSO2ZVBNQTC2L6ZS1HZGP1C3Q6BM9UZTTMB250LXN0CMV0 Y2G6MTAWJTTIYWNRZ3JVDW5KLWNVBG9YONRYYW5ZCGFYZW50IJ48YJ5VCGRHDGUNCIAGICAG ICAGICAGICMXOJWVYJ7COCBUAGUGAW50ZXJTAXR0ZW50IGRLZ3JHZGF0AW9UIG9MIEDPRVMT MTYGTWVZBY0YDQOGICAGICAGICAGU291BMRPBMCGCHJVZHVJDHMGD2FZIHJLC29SDMVKIG9U IEP1BMUGMTMSIDIWMTKGYXQGMTQ1OVOUPGJYPG0KICAGICAGICA8L2RPDJ4NCIAGICAGICAG PGRPDG0KC3R5BGU9INRLEHQTYWXPZ246BGVMDDTJB2XVCJPYZ2IOMZQSMZQSMZQPO3RLEHQT DHJHBNNMB3JTOM5VBMU7BGLUZS1OZWLNAHQ6MTKUOTLWEDT0ZXH0LWLUZGVUDDOWCHG7BGV0 DGVYLXNWYWNPBMC6BM9YBWFSO292ZXJMBG93ONZPC2LIBGU7ZM9UDC1ZAXPLOJEZLJMZCHG7 ZM9UDC1ZDHLSZTPUB3JTYWW7ZM9UDC12YXJPYW50OM5VCM1HBDTMB250LXDLAWDODDO0MDA7 DGV4DC1KZWNVCMF0AW9UOM5VBMU7D29YZC1ZCGFJAW5NOJBWEDT3AGL0ZS1ZCGFJZTPUB3JT YWW7ZM9UDC1ZAXPLLWFKANVZDDPUB25LO2ZVBNQTC3RYZXRJADOXMDALO2JHY2TNCM91BMQT Y29SB3I6DHJHBNNWYXJLBNQIPJXIPJXICJ4NCIAGICAGICAGICA8L2I+PC9KAXY+DQOGICAG ICAGIDXKAXYNCNN0EWXLPSJ0ZXH0LWFSAWDUOMXLZNQ7Y29SB3I6CMDIKDM0LDM0LDM0KTT0 ZXH0LXRYYW5ZZM9YBTPUB25LO2XPBMUTAGVPZ2H0OJE5LJK5CHG7DGV4DC1PBMRLBNQ6MHB4 O2XLDHRLCI1ZCGFJAW5NOM5VCM1HBDTVDMVYZMXVDZP2AXNPYMXLO2ZVBNQTC2L6ZTOXMY4Z M3B4O2ZVBNQTC3R5BGU6BM9YBWFSO2ZVBNQTDMFYAWFUDDPUB3JTYWW7ZM9UDC13ZWLNAHQ6 NDAWO3RLEHQTZGVJB3JHDGLVBJPUB25LO3DVCMQTC3BHY2LUZZOWCHG7D2HPDGUTC3BHY2U6 BM9YBWFSO2ZVBNQTC2L6ZS1HZGP1C3Q6BM9UZTTMB250LXN0CMV0Y2G6MTAWJTTIYWNRZ3JV DW5KLWNVBG9YONRYYW5ZCGFYZW50IJ48YJ5UB3BPYZONCIAGICAGICAGICAGIMKGPC9IPLBY B2R1Y3QGQW5VBWFSETRCOCBJBNRLCM1PDHRLBNQGZGVNCMFKYXRPB24GB2YGR09FUY0XNG0K ICAGICAGICAGIE1LC28TMIA8C3BHBIBJBGFZCZ0IZ21HAWWTBV8TNTIYODI3NJGZMTMZODC3 OTA1NMDTYWLSLWLSIJ5TB3VUZGLUZZWVC3BHBJ4NCIAGICAGICAGICBWCM9KDWN0CYBHBMQG DGHLAXIGZGLZDHJPYNV0AW9UIHRVIFBEQS48L2RPDJ4NCIAGICAGICAGPGRPDG0KC3R5BGU9 INRLEHQTYWXPZ246BGVMDDTJB2XVCJPYZ2IOMZQSMZQSMZQPO3RLEHQTDHJHBNNMB3JTOM5V BMU7BGLUZS1OZWLNAHQ6MTKUOTLWEDT0ZXH0LWLUZGVUDDOWCHG7BGV0DGVYLXNWYWNPBMC6 BM9YBWFSO292ZXJMBG93ONZPC2LIBGU7ZM9UDC1ZAXPLOJEZLJMZCHG7ZM9UDC1ZDHLSZTPU B3JTYWW7ZM9UDC12YXJPYW50OM5VCM1HBDTMB250LXDLAWDODDO0MDA7DGV4DC1KZWNVCMF0 AW9UOM5VBMU7D29YZC1ZCGFJAW5NOJBWEDT3AGL0ZS1ZCGFJZTPUB3JTYWW7ZM9UDC1ZAXPL LWFKANVZDDPUB25LO2ZVBNQTC3RYZXRJADOXMDALO2JHY2TNCM91BMQTY29SB3I6DHJHBNNW YXJLBNQIPJXICG0KC3R5BGU9IMXPBMUTAGVPZ2H0OJE5LJK5CHG7B3ZLCMZSB3C6DMLZAWJS ZTTMB250LXNPEMU6MTMUMZNWEDTMB250LXN0EWXLOM5VCM1HBDTMB250LXZHCMLHBNQ6BM9Y BWFSO2ZVBNQTD2VPZ2H0OJQWMDTMB250LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1ZDHJLDGNO OJEWMCUIPG0KICAGICAGICAGIDXZDHJVBMCNCNN0EWXLPSJSAW5LLWHLAWDODDOXOS45OXB4 O292ZXJMBG93ONZPC2LIBGU7ZM9UDC1ZAXPLOJEZLJMZCHG7ZM9UDC1ZDHLSZTPUB3JTYWW7 ZM9UDC12YXJPYW50OM5VCM1HBDTMB250LXDLAWDODDO3MDA7ZM9UDC1ZAXPLLWFKANVZDDPU B25LO2ZVBNQTC3RYZXRJADOXMDALIJ5EYXRLL1RPBWUNCIAGICAGICAGICAGIELZC3VLZDO8 L3N0CM9UZZ7COCBKDW5LPHNWYW4NCMNSYXNZPSJNBWFPBC1TXY01MJI4MJC2ODMXMZM4NZC5 MDU2Z21HAWWTBV8TNDYWMTI1NTQ2NDYZOTG3NZUWOWDTYWLSLW1FLTI3MJQ4MTUZMJMXODY1 NTUYOGDTYWLSLW1FLTG5NTE4MTQXOTGWNZU0MZM1ODHNBWFPBC1TXY0ZNTM3NZIYNDEZMJG3 MDE0MJI4Z21HAWWTBV8XMZY3NZI2OTU2NJG1NDU4NDY5Z21HAWWTBV81MZE3NJYWNDKXMTIX MDA5NTG5Z21HAWWTBV82ODI3OTG0MTK5NDUWMDA2MDNNBWFPBC1TXZQZMTQ5OTCWOTK0MTA1 NDY1MZZNBWFPBC1TXZM3NJIXNJU3MJU5MTGWOTYZMJLNBWFPBC1TXZQWNZEZNJU1MZI1NJMX NZUYNTLNBWFPBC1TXY04MJYWOTY5MDA3NDK1MTG4MJA3Z21HAWWTBV8TNTAZMTKWODU3NDC1 NJEZOTC1Z21HAWWTBV8TMTMXOTA0MTKWNTM2MDG2NTQWOGDTYWLSLW1FODC5NZC1OTC1MZC3 NDC3NJLNBWFPBC1TXZUXNTE4MJYWOTEYNJI0NTU0MTLNBWFPBC1TXZM2NTY5MTMXNTA4NJU5 NJG4NMDTYWLSLW1FMTM3NDC4MJE5ODKXNDQXNZYYNMDTYWLSLW1FNZK0MTE5ODY3ODEYNZMX MJGYNGDTYWLSLW1FNDIXMZY5MDM1MDE0MJI2NDK5N2DTYWLSLW1FNDGYMJEXNTK0MDMZNTY4 MJU4MGDTYWLSLW1FNZQ1NDGXMDCWOTKYNTM5MTG5N2DTYWLSLW1FLTU4MZCZNDUWNZG0OTU1 NTGYODNNBWFPBC1TXY04NJK0MTU4OTK5NTA5MTYXNJG0Z21HAWWTBV81NZYYOTAWNZKYNZA2 ODCZMZK0Z21HAWWTBV81NDA5ODEXMJU4MJI0NJA2MZI4Z21HAWWTBV8XODA2MTQXMZCZOTGW NJGWMDAWZ21HAWWTBV8YNDMWMDE3MTE2ODQ5NJI1MDE4Z21HAWWTBV84NDI2NDE3MDM5MTY2 NDCYNZG0Z21HAWWTBV81NJA2MZKXNJCXMDIYODY2NDLNBWFPBC1TXY0XODA0NJG4NJUZNJCY NZK2NZK4Z21HAWWTBV8TNDA1MDC4NJY1MDA5NJEXMJU1NGDTYWLSLW1FLTIZMTA5NZK5MDI4 MZQ3MZY3NDNNBWFPBC1TXZU1NJY0NZQ1MDKWNJYXNDG2MZNNBWFPBC1TXY0YOTA5NJMZOTAY ODKZNZG1MJY1Z21HAWWTBV83MZKXMDY0NZQXMTG5MTY0MDMXZ21HAWWTBV8TNZMZMDQ4MZK3 NZAYNTEZODKYZ21HAWWTBV8TNTK4OTMYNZQ0MDG2NZG3MJC0MGDTYWLSLW1FLTQWNTIWMZK2 MTK0OTKXODKYNTJNBWFPBC1TXZK4NJEWMZIZMZIXNDE3MJC2M2DTYWLSLW1FODAXNDA5MZGX ODE2NTE0MTVNBWFPBC1TXZGWNDMXMZY0NJA0NJA0MDM3N2DTYWLSLW1FLTC0NJU0MJQ1OTU3 NJGZMJYYNDHNBWFPBC1TXY03MDK1OTY4OTY0NDM4ODCXMJQ2Z21HAWWTYUJUIG0KC3R5BGU9 IMXPBMUTAGVPZ2H0OJE5LJK5CHG7B3ZLCMZSB3C6DMLZAWJSZTTMB250LXNPEMU6MTMUMZNW EDTMB250LXN0EWXLOM5VCM1HBDTMB250LXZHCMLHBNQ6BM9YBWFSO2ZVBNQTD2VPZ2H0OJQW MDTMB250LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCUIPJXZCGFUDQPJBGFZ CZ0IZ21HAWWTBV8TNTIYODI3NJGZMTMZODC3OTA1NMDTYWLSLW1FLTQ2MDEYNTU0NJQ2MZK4 NZC1MDLNBWFPBC1TXY0YNZI0ODE1MZIZMTG2NTU1MJHNBWFPBC1TXY04OTUXODE0MTK4MDC1 NDMZNTG4Z21HAWWTBV8TMZUZNZCYMJQXMZI4NZAXNDIYOGDTYWLSLW1FMTM2NZCYNJK1NJY4 NTQ1ODQ2OWDTYWLSLW1FNTMXNZY2MDQ5MTEYMTAWOTU4OWDTYWLSLW1FNJGYNZK4NDE5OTQ1 MDAWNJAZZ21HAWWTBV80MZE0OTK3MDK5NDEWNTQ2NTM2Z21HAWWTBV8ZNZYYMTY1NZI1OTE4 MDK2MZI5Z21HAWWTBV80MDCXMZY1NTMYNTYZMTC1MJU5Z21HAWWTBV8TODI2MDK2OTAWNZQ5 NTE4ODIWN2DTYWLSLW1FLTUWMZE5MDG1NZQ3NTYXMZK3NWDTYWLSLW1FLTEZMTKWNDE5MDUZ NJA4NJU0MDHNBWFPBC1TXZG3OTC3NTK3NTM3NZQ3NZY5Z21HAWWTBV81MTUXODI2MDKXMJYY NDU1NDE5Z21HAWWTBV8ZNJU2OTEZMTUWODY1OTY4ODZNBWFPBC1TXZEZNZQ3ODIXOTG5MTQ0 MTC2MJZNBWFPBC1TXZC5NDEXOTG2NZGXMJCZMTI4MJRNBWFPBC1TXZQYMTM2OTAZNTAXNDIY NJQ5OTDNBWFPBC1TXZQ4MJIXMTU5NDAZMZU2ODI1ODBNBWFPBC1TXZC0NTQ4MTA3MDK5MJUZ OTE4OTDNBWFPBC1TXY01ODM3MZQ1MDC4NDK1NTU4MJGZZ21HAWWTBV8TODY5NDE1ODK5OTUW OTE2MTY4NGDTYWLSLW1FNTC2MJKWMDC5MJCWNJG3MZM5NGDTYWLSLW1FNTQWOTGXMTI1ODIY NDYWNJMYOGDTYWLSLW1FMTGWNJE0MTM3MZK4MDY4MDAWMGDTYWLSLW1FMJQZMDAXNZEXNJG0 OTYYNTAXOGDTYWLSLW1FODQYNJQXNZAZOTE2NJQ3MJC4NGDTYWLSLW1FNTYWNJM5MTY3MTAY MJG2NJQ5Z21HAWWTBV8TMTGWNDY4ODY1MZY3MJC5NJC5OGDTYWLSLW1FLTQWNTA3ODY2NTAW OTYXMTI1NTRNBWFPBC1TXY0YMZEWOTC5OTAYODM0NZM2NZQZZ21HAWWTBV81NTY2NDC0NTA5 MDY2MTQ4NJMZZ21HAWWTBV8TMJKWOTYZMZKWMJG5MZC4NTI2NWDTYWLSLW1FNZM5MTA2NDC0 MTE4OTE2NDAZMWDTYWLSLW1FLTCZMZA0ODM5NZCWMJUXMZG5MMDTYWLSLW1FLTU5ODKZMJC0 NDA4NJC4NZI3NDBNBWFPBC1TXY00MDUYMDM5NJE5NDK5MTG5MJUYZ21HAWWTBV85ODYXMDMY MZMYMTQXNZI3NJNNBWFPBC1TXZGWMTQWOTM4MTGXNJUXNDE1Z21HAWWTBV84MDQZMTM2NDYW NDYWNDAZNZDNBWFPBC1TXY03NDY1NDI0NTK1NZY4MZI2MJQ4Z21HAWWTBV8TNZA5NTK2ODK2 NDQZODG3MTI0NMDTYWLSLWFRSIINCNN0EWXLPSJSAW5LLWHLAWDODDOXOS45OXB4O292ZXJM BG93ONZPC2LIBGU7ZM9UDC1ZAXPLOJEZLJMZCHG7ZM9UDC1ZDHLSZTPUB3JTYWW7ZM9UDC12 YXJPYW50OM5VCM1HBDTMB250LXDLAWDODDO0MDA7ZM9UDC1ZAXPLLWFKANVZDDPUB25LO2ZV BNQTC3RYZXRJADOXMDALIJ4NCIAGICAGICAGICAGICAGMTMSIDIWMTKGMJA0MLO8L3NWYW4+ PC9ZCGFUPJWVZGL2PG0KICAGICAGICA8ZGL2DQPZDHLSZT0IDGV4DC1HBGLNBJPSZWZ0O2NV BG9YONJNYIGZNCWZNCWZNCK7DGV4DC10CMFUC2ZVCM06BM9UZTTSAW5LLWHLAWDODDOXOS45 OXB4O3RLEHQTAW5KZW50OJBWEDTSZXR0ZXITC3BHY2LUZZPUB3JTYWW7B3ZLCMZSB3C6DMLZ AWJSZTTMB250LXNPEMU6MTMUMZNWEDTMB250LXN0EWXLOM5VCM1HBDTMB250LXZHCMLHBNQ6 BM9YBWFSO2ZVBNQTD2VPZ2H0OJQWMDT0ZXH0LWRLY29YYXRPB246BM9UZTT3B3JKLXNWYWNP BMC6MHB4O3DOAXRLLXNWYWNLOM5VCM1HBDTMB250LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1Z DHJLDGNOOJEWMCU7YMFJA2DYB3VUZC1JB2XVCJP0CMFUC3BHCMVUDCI+PGJYDQPZDHLSZT0I BGLUZS1OZWLNAHQ6MTKUOTLWEDTVDMVYZMXVDZP2AXNPYMXLO2ZVBNQTC2L6ZTOXMY4ZM3B4 O2ZVBNQTC3R5BGU6BM9YBWFSO2ZVBNQTDMFYAWFUDDPUB3JTYWW7ZM9UDC13ZWLNAHQ6NDAW O2ZVBNQTC2L6ZS1HZGP1C3Q6BM9UZTTMB250LXN0CMV0Y2G6MTAWJSI+DQOGICAGICAGICAG PGI+UHJVZHVJDCHZKSBVCIBEYXRHIELTCGFJDGVKOSKGPC9IPIBJBNRLCM1PDHRLBNQGZGVN CMFKYXRPB24NCIAGICAGICAGICBVZSKGPHNWYW4NCNN0EWXLPSJ0ZXH0LWFSAWDUOMXLZNQ7 Y29SB3I6CMDIKDM0LDM0LDM0KTT0ZXH0LXRYYW5ZZM9YBTPUB25LO2XPBMUTAGVPZ2H0OJE5 LJK5CHG7DGV4DC1PBMRLBNQ6MHB4O2XLDHRLCI1ZCGFJAW5NOM5VCM1HBDTMB250LXNPEMU6 MTMUMZNWEDTMB250LXN0EWXLOM5VCM1HBDTMB250LXZHCMLHBNQ6BM9YBWFSO2ZVBNQTD2VP Z2H0OJQWMDT0ZXH0LWRLY29YYXRPB246BM9UZTT3B3JKLXNWYWNPBMC6MHB4O2RPC3BSYXK6 AW5SAW5LO3DOAXRLLXNWYWNLOM5VCM1HBDTMB250LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1Z DHJLDGNOOJEWMCU7ZMXVYXQ6BM9UZTTIYWNRZ3JVDW5KLWNVBG9YONJNYIGYNTUSMJU1LDI1 NSKIPKDPRVMTMTYNCIAGICAGICAGICAGIE1LC28TMIA8C3BHBIBJBGFZCZ0IZ21HAWWTBV8T NTIYODI3NJGZMTMZODC3OTA1NMDTYWLSLWLSIJ5TB3VUZGLUZZWVC3BHBJ4NCIAGICAGICAG ICAGIHBYB2R1Y3RZICHMZWDHY3KGVMVYDGLJYWWGVGVTCGVYYXR1CMUSIEXLZ2FJESBWZXJ0 AWNHBA0KICAGICAGICAGICAGTW9PC3R1CMUSIFRVDGFSIFBYZWNPCGL0YWJSZSBXYXRLCIKG YW5KIHROZWLYIGRPC3RYAWJ1DGLVBG0KICAGICAGICAGICAGDG8GUERBLJWVC3BHBJ48L2RP DJ4NCIAGICAGICAGPGRPDG0KC3R5BGU9INRLEHQTYWXPZ246BGVMDDTJB2XVCJPYZ2IOMZQS MZQSMZQPO3RLEHQTDHJHBNNMB3JTOM5VBMU7BGLUZS1OZWLNAHQ6MTKUOTLWEDT0ZXH0LWLU ZGVUDDOWCHG7BGV0DGVYLXNWYWNPBMC6BM9YBWFSO292ZXJMBG93ONZPC2LIBGU7ZM9UDC1Z AXPLOJEZLJMZCHG7ZM9UDC1ZDHLSZTPUB3JTYWW7ZM9UDC12YXJPYW50OM5VCM1HBDTMB250 LXDLAWDODDO0MDA7DGV4DC1KZWNVCMF0AW9UOM5VBMU7D29YZC1ZCGFJAW5NOJBWEDT3AGL0 ZS1ZCGFJZTPUB3JTYWW7ZM9UDC1ZAXPLLWFKANVZDDPUB25LO2ZVBNQTC3RYZXRJADOXMDAL O2JHY2TNCM91BMQTY29SB3I6DHJHBNNWYXJLBNQIPJXICG0KC3R5BGU9IMXPBMUTAGVPZ2H0 OJE5LJK5CHG7B3ZLCMZSB3C6DMLZAWJSZTTMB250LXNPEMU6MTMUMZNWEDTMB250LXN0EWXL OM5VCM1HBDTMB250LXZHCMLHBNQ6BM9YBWFSO2ZVBNQTD2VPZ2H0OJQWMDTMB250LXNPEMUT YWRQDXN0OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCUIPG0KICAGICAGICAGIDXZDHJVBMCNCNN0 EWXLPSJSAW5LLWHLAWDODDOXOS45OXB4O292ZXJMBG93ONZPC2LIBGU7ZM9UDC1ZAXPLOJEZ LJMZCHG7ZM9UDC1ZDHLSZTPUB3JTYWW7ZM9UDC12YXJPYW50OM5VCM1HBDTMB250LXDLAWDO DDO3MDA7ZM9UDC1ZAXPLLWFKANVZDDPUB25LO2ZVBNQTC3RYZXRJADOXMDALIJ5EYXRLL1RP BWUNCIAGICAGICAGICAGIG9MIELUAXRPYWWGSW1WYWN0OSKGPC9ZDHJVBMC+IEP1BMUGMTI8 C3BHBG0KY2XHC3M9IMDTYWLSLW1FLTUYMJGYNZY4MZEZMZG3NZKWNTZNBWFPBC1TXY00NJAX MJU1NDY0NJM5ODC3NTA5Z21HAWWTBV8TMJCYNDGXNTMYMZE4NJU1NTI4Z21HAWWTBV8TODK1 MTGXNDE5ODA3NTQZMZU4OGDTYWLSLW1FLTM1MZC3MJI0MTMYODCWMTQYMJHNBWFPBC1TXZEZ NJC3MJY5NTY2ODU0NTG0NJLNBWFPBC1TXZUZMTC2NJA0OTEXMJEWMDK1ODLNBWFPBC1TXZY4 MJC5ODQXOTK0NTAWMDYWM2DTYWLSLW1FNDMXNDK5NZA5OTQXMDU0NJUZNMDTYWLSLW1FMZC2 MJE2NTCYNTKXODA5NJMYOWDTYWLSLW1FNDA3MTM2NTUZMJU2MZE3NTI1OWDTYWLSLW1FLTGY NJA5NJKWMDC0OTUXODGYMDDNBWFPBC1TXY01MDMXOTA4NTC0NZU2MTM5NZVNBWFPBC1TXY0X MZE5MDQXOTA1MZYWODY1NDA4Z21HAWWTBV84NZK3NZU5NZUZNZC0NZC2OWDTYWLSLW1FNTE1 MTGYNJA5MTI2MJQ1NTQXOWDTYWLSLW1FMZY1NJKXMZE1MDG2NTK2ODG2Z21HAWWTBV8XMZC0 NZGYMTK4OTE0NDE3NJI2Z21HAWWTBV83OTQXMTK4NJC4MTI3MZEYODI0Z21HAWWTBV80MJEZ NJKWMZUWMTQYMJY0OTK3Z21HAWWTBV80ODIYMTE1OTQWMZM1NJGYNTGWZ21HAWWTBV83NDU0 ODEWNZA5OTI1MZKXODK3Z21HAWWTBV8TNTGZNZM0NTA3ODQ5NTU1ODI4M2DTYWLSLW1FLTG2 OTQXNTG5OTK1MDKXNJE2ODRNBWFPBC1TXZU3NJI5MDA3OTI3MDY4NZMZOTRNBWFPBC1TXZU0 MDK4MTEYNTGYMJQ2MDYZMJHNBWFPBC1TXZE4MDYXNDEZNZM5ODA2ODAWMDBNBWFPBC1TXZI0 MZAWMTCXMTY4NDK2MJUWMTHNBWFPBC1TXZG0MJY0MTCWMZKXNJY0NZI3ODRNBWFPBC1TXZU2 MDYZOTE2NZEWMJI4NJY0OWDTYWLSLW1FLTE4MDQ2ODG2NTM2NZI3OTY3OTHNBWFPBC1TXY00 MDUWNZG2NJUWMDK2MTEYNTU0Z21HAWWTBV8TMJMXMDK3OTKWMJGZNDCZNJC0M2DTYWLSLW1F NTU2NJQ3NDUWOTA2NJE0ODYZM2DTYWLSLW1FLTI5MDK2MZM5MDI4OTM3ODUYNJVNBWFPBC1T XZCZOTEWNJQ3NDEXODKXNJQWMZFNBWFPBC1TXY03MZMWNDGZOTC3MDI1MTM4OTJNBWFPBC1T XY01OTG5MZI3NDQWODY3ODCYNZQWZ21HAWWTBV8TNDA1MJAZOTYXOTQ5OTE4OTI1MMDTYWLS LW1FOTG2MTAZMJMZMJE0MTCYNZYZZ21HAWWTBV84MDE0MDKZODE4MTY1MTQXNWDTYWLSLW1F ODA0MZEZNJQ2MDQ2MDQWMZC3Z21HAWWTBV8TNZQ2NTQYNDU5NTC2ODMYNJI0OGDTYWLSLW1F LTCWOTU5NJG5NJQ0MZG4NZEYNDZNBWFPBC1HQM4IDQPZDHLSZT0IBGLUZS1OZWLNAHQ6MTKU OTLWEDTVDMVYZMXVDZP2AXNPYMXLO2ZVBNQTC2L6ZTOXMY4ZM3B4O2ZVBNQTC3R5BGU6BM9Y BWFSO2ZVBNQTDMFYAWFUDDPUB3JTYWW7ZM9UDC13ZWLNAHQ6NDAWO2ZVBNQTC2L6ZS1HZGP1 C3Q6BM9UZTTMB250LXN0CMV0Y2G6MTAWJSI+PHNWYW4NCMNSYXNZPSJNBWFPBC1TXY01MJI4 MJC2ODMXMZM4NZC5MDU2Z21HAWWTBV8TNDYWMTI1NTQ2NDYZOTG3NZUWOWDTYWLSLW1FLTI3 MJQ4MTUZMJMXODY1NTUYOGDTYWLSLW1FLTG5NTE4MTQXOTGWNZU0MZM1ODHNBWFPBC1TXY0Z NTM3NZIYNDEZMJG3MDE0MJI4Z21HAWWTBV8XMZY3NZI2OTU2NJG1NDU4NDY5Z21HAWWTBV81 MZE3NJYWNDKXMTIXMDA5NTG5Z21HAWWTBV82ODI3OTG0MTK5NDUWMDA2MDNNBWFPBC1TXZQZ MTQ5OTCWOTK0MTA1NDY1MZZNBWFPBC1TXZM3NJIXNJU3MJU5MTGWOTYZMJLNBWFPBC1TXZQW NZEZNJU1MZI1NJMXNZUYNTLNBWFPBC1TXY04MJYWOTY5MDA3NDK1MTG4MJA3Z21HAWWTBV8T NTAZMTKWODU3NDC1NJEZOTC1Z21HAWWTBV8TMTMXOTA0MTKWNTM2MDG2NTQWOGDTYWLSLW1F ODC5NZC1OTC1MZC3NDC3NJLNBWFPBC1TXZUXNTE4MJYWOTEYNJI0NTU0MTLNBWFPBC1TXZM2 NTY5MTMXNTA4NJU5NJG4NMDTYWLSLW1FMTM3NDC4MJE5ODKXNDQXNZYYNMDTYWLSLW1FNZK0 MTE5ODY3ODEYNZMXMJGYNGDTYWLSLW1FNDIXMZY5MDM1MDE0MJI2NDK5N2DTYWLSLW1FNDGY MJEXNTK0MDMZNTY4MJU4MGDTYWLSLW1FNZQ1NDGXMDCWOTKYNTM5MTG5N2DTYWLSLW1FLTU4 MZCZNDUWNZG0OTU1NTGYODNNBWFPBC1TXY04NJK0MTU4OTK5NTA5MTYXNJG0Z21HAWWTBV81 NZYYOTAWNZKYNZA2ODCZMZK0Z21HAWWTBV81NDA5ODEXMJU4MJI0NJA2MZI4Z21HAWWTBV8X ODA2MTQXMZCZOTGWNJGWMDAWZ21HAWWTBV8YNDMWMDE3MTE2ODQ5NJI1MDE4Z21HAWWTBV84 NDI2NDE3MDM5MTY2NDCYNZG0Z21HAWWTBV81NJA2MZKXNJCXMDIYODY2NDLNBWFPBC1TXY0X ODA0NJG4NJUZNJCYNZK2NZK4Z21HAWWTBV8TNDA1MDC4NJY1MDA5NJEXMJU1NGDTYWLSLW1F LTIZMTA5NZK5MDI4MZQ3MZY3NDNNBWFPBC1TXZU1NJY0NZQ1MDKWNJYXNDG2MZNNBWFPBC1T XY0YOTA5NJMZOTAYODKZNZG1MJY1Z21HAWWTBV83MZKXMDY0NZQXMTG5MTY0MDMXZ21HAWWT BV8TNZMZMDQ4MZK3NZAYNTEZODKYZ21HAWWTBV8TNTK4OTMYNZQ0MDG2NZG3MJC0MGDTYWLS LW1FLTQWNTIWMZK2MTK0OTKXODKYNTJNBWFPBC1TXZK4NJEWMZIZMZIXNDE3MJC2M2DTYWLS LW1FODAXNDA5MZGXODE2NTE0MTVNBWFPBC1TXZGWNDMXMZY0NJA0NJA0MDM3N2DTYWLSLW1F LTC0NJU0MJQ1OTU3NJGZMJYYNDHNBWFPBC1TXY03MDK1OTY4OTY0NDM4ODCXMJQ2Z21HAWWT YVFKIG0KC3R5BGU9IMXPBMUTAGVPZ2H0OJE5LJK5CHG7B3ZLCMZSB3C6DMLZAWJSZTTMB250 LXNPEMU6MTMUMZNWEDTMB250LXN0EWXLOM5VCM1HBDTMB250LXZHCMLHBNQ6BM9YBWFSO2ZV BNQTD2VPZ2H0OJQWMDTMB250LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCUI PIWNCIAGICAGICAGICAGICAGMJAXOSAYMTE1WJWVC3BHBJ48L3NWYW4+PGJYDQPZDHLSZT0I BGLUZS1OZWLNAHQ6MTKUOTLWEDTVDMVYZMXVDZP2AXNPYMXLO2ZVBNQTC2L6ZTOXMY4ZM3B4 O2ZVBNQTC3R5BGU6BM9YBWFSO2ZVBNQTDMFYAWFUDDPUB3JTYWW7ZM9UDC13ZWLNAHQ6NDAW O2ZVBNQTC2L6ZS1HZGP1C3Q6BM9UZTTMB250LXN0CMV0Y2G6MTAWJSI+DQOGICAGICAGICAG PGJYDQPZDHLSZT0IBGLUZS1OZWLNAHQ6MTKUOTLWEDTVDMVYZMXVDZP2AXNPYMXLO2ZVBNQT C2L6ZTOXMY4ZM3B4O2ZVBNQTC3R5BGU6BM9YBWFSO2ZVBNQTDMFYAWFUDDPUB3JTYWW7ZM9U DC13ZWLNAHQ6NDAWO2ZVBNQTC2L6ZS1HZGP1C3Q6BM9UZTTMB250LXN0CMV0Y2G6MTAWJSI+ DQOGICAGICAGICAGPGI+RGF0ZS9UAW1LIG9MIEV4CGVJDGVKIEVUZDO8L2I+WQAGSNVUZSAX MYWGMJAXOSAXNDU5WJXICG0KC3R5BGU9IMXPBMUTAGVPZ2H0OJE5LJK5CHG7B3ZLCMZSB3C6 DMLZAWJSZTTMB250LXNPEMU6MTMUMZNWEDTMB250LXN0EWXLOM5VCM1HBDTMB250LXZHCMLH BNQ6BM9YBWFSO2ZVBNQTD2VPZ2H0OJQWMDTMB250LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1Z DHJLDGNOOJEWMCUIPG0KICAGICAGICAGIDXICG0KC3R5BGU9IMXPBMUTAGVPZ2H0OJE5LJK5 CHG7B3ZLCMZSB3C6DMLZAWJSZTTMB250LXNPEMU6MTMUMZNWEDTMB250LXN0EWXLOM5VCM1H BDTMB250LXZHCMLHBNQ6BM9YBWFSO2ZVBNQTD2VPZ2H0OJQWMDTMB250LXNPEMUTYWRQDXN0 OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCUIPG0KICAGICAGICAGIDXIPKXLBMD0ACBVZIBFDMVU DDO8L2I+WQAGMTCGAG91CNMSIDQ0IG1PBNV0ZXM8YNINCNN0EWXLPSJSAW5LLWHLAWDODDOX OS45OXB4O292ZXJMBG93ONZPC2LIBGU7ZM9UDC1ZAXPLOJEZLJMZCHG7ZM9UDC1ZDHLSZTPU B3JTYWW7ZM9UDC12YXJPYW50OM5VCM1HBDTMB250LXDLAWDODDO0MDA7ZM9UDC1ZAXPLLWFK ANVZDDPUB25LO2ZVBNQTC3RYZXRJADOXMDALIJ4NCIAGICAGICAGICA8YNINCNN0EWXLPSJS AW5LLWHLAWDODDOXOS45OXB4O292ZXJMBG93ONZPC2LIBGU7ZM9UDC1ZAXPLOJEZLJMZCHG7 ZM9UDC1ZDHLSZTPUB3JTYWW7ZM9UDC12YXJPYW50OM5VCM1HBDTMB250LXDLAWDODDO0MDA7 ZM9UDC1ZAXPLLWFKANVZDDPUB25LO2ZVBNQTC3RYZXRJADOXMDALIJ4NCIAGICAGICAGICA8 YJ5EZXRHAWXZL1NWZWNPZMLJCYBVZIBDAGFUZ2U6PC9IPSKGIDXZCGFUDQPZDHLSZT0IDGV4 DC1HBGLNBJPSZWZ0O2NVBG9YONJNYIGZNCWZNCWZNCK7DGV4DC10CMFUC2ZVCM06BM9UZTTS AW5LLWHLAWDODDOXOS45OXB4O3RLEHQTAW5KZW50OJBWEDTSZXR0ZXITC3BHY2LUZZPUB3JT YWW7ZM9UDC1ZAXPLOJEZLJMZCHG7ZM9UDC1ZDHLSZTPUB3JTYWW7ZM9UDC12YXJPYW50OM5V CM1HBDTMB250LXDLAWDODDO0MDA7DGV4DC1KZWNVCMF0AW9UOM5VBMU7D29YZC1ZCGFJAW5N OJBWEDTKAXNWBGF5OMLUBGLUZTT3AGL0ZS1ZCGFJZTPUB3JTYWW7ZM9UDC1ZAXPLLWFKANVZ DDPUB25LO2ZVBNQTC3RYZXRJADOXMDALO2ZSB2F0OM5VBMU7YMFJA2DYB3VUZC1JB2XVCJPY Z2IOMJU1LDI1NSWYNTUPIJ5JBNRLCM1PDHRLBNQNCIAGICAGICAGICAGIGRLZ3JHZGF0AW9U IG9MWQA8L3NWYW4+PHNWYW4NCNN0EWXLPSJ0ZXH0LWFSAWDUOMXLZNQ7Y29SB3I6CMDIKDM0 LDM0LDM0KTT0ZXH0LXRYYW5ZZM9YBTPUB25LO2XPBMUTAGVPZ2H0OJE5LJK5CHG7DGV4DC1P BMRLBNQ6MHB4O2XLDHRLCI1ZCGFJAW5NOM5VCM1HBDTMB250LXNPEMU6MTMUMZNWEDTMB250 LXN0EWXLOM5VCM1HBDTMB250LXZHCMLHBNQ6BM9YBWFSO2ZVBNQTD2VPZ2H0OJQWMDT0ZXH0 LWRLY29YYXRPB246BM9UZTT3B3JKLXNWYWNPBMC6MHB4O2RPC3BSYXK6AW5SAW5LO3DOAXRL LXNWYWNLOM5VCM1HBDTMB250LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCU7 ZMXVYXQ6BM9UZTTIYWNRZ3JVDW5KLWNVBG9YONJNYIGYNTUSMJU1LDI1NSKIPKDPRVMTMTYN CIAGICAGICAGICAGIE1LC28TMIA8C3BHBIBJBGFZCZ0IZ21HAWWTBV8TNTIYODI3NJGZMTMZ ODC3OTA1NMDTYWLSLWLSIJ5TB3VUZGLUZZWVC3BHBJ4NCIAGICAGICAGICAGIHBYB2R1Y3RZ ICHMZWDHY3KGVMVYDGLJYWWGVGVTCGVYYXR1CMUSIEXLZ2FJESBWZXJ0AWNHBA0KICAGICAG ICAGICAGTW9PC3R1CMUSIFRVDGFSIFBYZWNPCGL0YWJSZSBXYXRLCIKGYW5KIHROZWLYIGRP C3RYAWJ1DGLVBG0KICAGICAGICAGICAGDG8GUERBIGR1ZSB0BYBHBIBHBM9TYWX5LJWVC3BH BJ7COMKGPHN0CM9UZW0KC3R5BGU9IMXPBMUTAGVPZ2H0OJE5LJK5CHG7B3ZLCMZSB3C6DMLZ AWJSZTTMB250LXNPEMU6MTMUMZNWEDTMB250LXN0EWXLOM5VCM1HBDTMB250LXZHCMLHBNQ6 BM9YBWFSO2ZVBNQTD2VPZ2H0OJCWMDTMB250LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1ZDHJL DGNOOJEWMCUIPSKGWQA8L3N0CM9UZZ7COMKGWQANCIAGICAGICAGICA8C3RYB25NDQPZDHLS ZT0IBGLUZS1OZWLNAHQ6MTKUOTLWEDTVDMVYZMXVDZP2AXNPYMXLO2ZVBNQTC2L6ZTOXMY4Z M3B4O2ZVBNQTC3R5BGU6BM9YBWFSO2ZVBNQTDMFYAWFUDDPUB3JTYWW7ZM9UDC13ZWLNAHQ6 NZAWO2ZVBNQTC2L6ZS1HZGP1C3Q6BM9UZTTMB250LXN0CMV0Y2G6MTAWJSI+WQA8L3N0CM9U ZZ48L2RPDJ4NCIAGICAGICAGPGRPDG0KC3R5BGU9INRLEHQTYWXPZ246BGVMDDTJB2XVCJPY Z2IOMZQSMZQSMZQPO3RLEHQTDHJHBNNMB3JTOM5VBMU7BGLUZS1OZWLNAHQ6MTKUOTLWEDT0 ZXH0LWLUZGVUDDOWCHG7BGV0DGVYLXNWYWNPBMC6BM9YBWFSO292ZXJMBG93ONZPC2LIBGU7 ZM9UDC1ZAXPLOJEZLJMZCHG7ZM9UDC1ZDHLSZTPUB3JTYWW7ZM9UDC12YXJPYW50OM5VCM1H BDTMB250LXDLAWDODDO0MDA7DGV4DC1KZWNVCMF0AW9UOM5VBMU7D29YZC1ZCGFJAW5NOJBW EDT3AGL0ZS1ZCGFJZTPUB3JTYWW7ZM9UDC1ZAXPLLWFKANVZDDPUB25LO2ZVBNQTC3RYZXRJ ADOXMDALO2JHY2TNCM91BMQTY29SB3I6DHJHBNNWYXJLBNQIPSKGWQDCOMKGWQA8YNINCNN0 EWXLPSJSAW5LLWHLAWDODDOXOS45OXB4O292ZXJMBG93ONZPC2LIBGU7ZM9UDC1ZAXPLOJEZ LJMZCHG7ZM9UDC1ZDHLSZTPUB3JTYWW7ZM9UDC12YXJPYW50OM5VCM1HBDTMB250LXDLAWDO DDO0MDA7ZM9UDC1ZAXPLLWFKANVZDDPUB25LO2ZVBNQTC3RYZXRJADOXMDALIJ4NCIAGICAG ICAGICA8YG0KC3R5BGU9IMXPBMUTAGVPZ2H0OJE5LJK5CHG7B3ZLCMZSB3C6DMLZAWJSZTTM B250LXNPEMU6MTMUMZNWEDTMB250LXN0EWXLOM5VCM1HBDTMB250LXZHCMLHBNQ6BM9YBWFS O2ZVBNQTD2VPZ2H0OJCWMDTMB250LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1ZDHJLDGNOOJEW MCUIPKNVBNRHY3QNCIAGICAGICAGICAGIELUZM9YBWF0AW9UIGZVCIBGDXJ0AGVYIELUZM9Y BWF0AW9UOIA8L2I+PGENCIAGICAGICAGICAGIHN0EWXLPSJJB2XVCJPYZ2IOMTCSODUSMJA0 KSIGAHJLZJ0IBWFPBHRVONJVC3MUY294QG5VYWEUZ292IG0KICAGICAGICAGICAGDGFYZ2V0 PSJFYMXHBMSIIG1VEI1KBY1UB3QTC2VUZD0IDHJ1ZSI+PHNWYW4NCMLKPSJNBWFPBC1TXY01 MJI4MJC2ODMXMZM4NZC5MDU2Z21HAWWTBV8TNDYWMTI1NTQ2NDYZOTG3NZUWOWDTYWLSLW1F LTI3MJQ4MTUZMJMXODY1NTUYOGDTYWLSLW1FLTG5NTE4MTQXOTGWNZU0MZM1ODHNBWFPBC1T XY0ZNTM3NZIYNDEZMJG3MDE0MJI4Z21HAWWTBV8XMZY3NZI2OTU2NJG1NDU4NDY5Z21HAWWT BV81MZE3NJYWNDKXMTIXMDA5NTG5Z21HAWWTBV82ODI3OTG0MTK5NDUWMDA2MDNNBWFPBC1T XZQZMTQ5OTCWOTK0MTA1NDY1MZZNBWFPBC1TXZM3NJIXNJU3MJU5MTGWOTYZMJLNBWFPBC1T XZQWNZEZNJU1MZI1NJMXNZUYNTLNBWFPBC1TXY04MJYWOTY5MDA3NDK1MTG4MJA3Z21HAWWT BV8TNTAZMTKWODU3NDC1NJEZOTC1OJFHAI40IG0KICAGICAGICAGICAGICBZDHLSZT0IY29S B3I6CMDIKDE3LDG1LDIWNCKIPNJVC3M8L3NWYW4+LMNVEEA8C3BHBG0KAWQ9IMDTYWLSLW1F LTUYMJGYNZY4MZEZMZG3NZKWNTZNBWFPBC1TXY00NJAXMJU1NDY0NJM5ODC3NTA5Z21HAWWT BV8TMJCYNDGXNTMYMZE4NJU1NTI4Z21HAWWTBV8TODK1MTGXNDE5ODA3NTQZMZU4OGDTYWLS LW1FLTM1MZC3MJI0MTMYODCWMTQYMJHNBWFPBC1TXZEZNJC3MJY5NTY2ODU0NTG0NJLNBWFP BC1TXZUZMTC2NJA0OTEXMJEWMDK1ODLNBWFPBC1TXZY4MJC5ODQXOTK0NTAWMDYWM2DTYWLS LW1FNDMXNDK5NZA5OTQXMDU0NJUZNMDTYWLSLW1FMZC2MJE2NTCYNTKXODA5NJMYOWDTYWLS LW1FNDA3MTM2NTUZMJU2MZE3NTI1OWDTYWLSLW1FLTGYNJA5NJKWMDC0OTUXODGYMDDNBWFP BC1TXY01MDMXOTA4NTC0NZU2MTM5NZU6MWFQLJUIDQOGICAGICAGICAGICAGIHN0EWXLPSJJ B2XVCJPYZ2IOMTCSODUSMJA0KSI+BM9HYTWVC3BHBJ4UZ292PC9HPJWVZGL2PG0KICAGICAG ICA8ZGL2DQPZDHLSZT0IDGV4DC1HBGLNBJPSZWZ0O2NVBG9YONJNYIGZNCWZNCWZNCK7DGV4 DC10CMFUC2ZVCM06BM9UZTTSAW5LLWHLAWDODDOXOS45OXB4O3RLEHQTAW5KZW50OJBWEDTS ZXR0ZXITC3BHY2LUZZPUB3JTYWW7B3ZLCMZSB3C6DMLZAWJSZTTMB250LXNPEMU6MTMUMZNW EDTMB250LXN0EWXLOM5VCM1HBDTMB250LXZHCMLHBNQ6BM9YBWFSO2ZVBNQTD2VPZ2H0OJQW MDT0ZXH0LWRLY29YYXRPB246BM9UZTT3B3JKLXNWYWNPBMC6MHB4O3DOAXRLLXNWYWNLOM5V CM1HBDTMB250LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCU7YMFJA2DYB3VU ZC1JB2XVCJP0CMFUC3BHCMVUDCI+DQOGICAGICAGICAGPGRPDIBZDHLSZT0IZM9UDDO0MDAG MTMUMZNWEC8XOS45OXB4DQPBCMLHBCXIZWX2ZXRPY2ESC2FUCY1ZZXJPZJT0ZXH0LWFSAWDU OMXLZNQ7Y29SB3I6CMDIKDM0LDM0LDM0KTT0ZXH0LXRYYW5ZZM9YBTPUB25LO3RLEHQTAW5K ZW50OJBWEDTSZXR0ZXITC3BHY2LUZZPUB3JTYWW7B3ZLCMZSB3C6DMLZAWJSZTT0ZXH0LWRL Y29YYXRPB246BM9UZTT3B3JKLXNWYWNPBMC6MHB4O3DOAXRLLXNWYWNLOM5VCM1HBDTMB250 LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCU7YMFJA2DYB3VUZC1JB2XVCJP0 CMFUC3BHCMVUDCI+DQOGICAGICAGICAGICA8CCBJBGFZCZ0ITXNVTM9YBWFSIJ48YJ5XZWIG U2L0ZSHZKSBMB3IGYXBWBGLJYWJSZQ0KICAGICAGICAGICAGICAGIGLUZM9YBWF0AW9UOJWV YJ48C3BHBJ4GTI9BIDXICJ4NCIAGICAGICAGICAGICAGPC9ZCGFUPJWVCD4NCIAGICAGICAG ICAGIDXWIGNSYXNZPSJNC29OB3JTYWWIPJXZCGFUPJWVC3BHBJ4GVGHPCYBTZXNZYWDLIHDH CYBZZW50DQOGICAGICAGICAGICAGIGZYB20GPGENCMNSYXNZPSJNBWFPBC1TXY01NTE1OTMX ODIZNZQ4NZG5MZG4BV8YMJQYNTG2ODAWNTU0MTGWMJUWZ21HAWWTBV85MDM3MZMWNDM1NZQX ODYXMTHTB3OTDHH0LWXPBMSTYWJICMV2AWF0ZWQIDQOGICAGICAGICAGICAGICAGAHJLZJ0I BWFPBHRVOKVTUEMUTM90AWZPY2F0AW9UQG5VYWEUZ292IIB0YXJNZXQ9IL9IBGFUAYINCIAG ICAGICAGICAGICAGICBTB3OTZG8TBM90LXNLBMQ9INRYDWUIPKVTUEMUTM90AWZPY2F0AW9U QG5VYWEUZ292PC9HPI4NCIAGICAGICAGICAGICAGWW91IGHHDMUGYMVLBIBZZW50IHROAXMG YW5KIG90AGVYIG5VDGLMAWNHDGLVBNMGYMVJYXVZZQ0KICAGICAGICAGICAGICB5B3UGAGF2 ZSBVCHRLZCBPBIB0BYBYZWNLAXZLIGL0LIBJZIBMB3IGYW55IHJLYXNVBIWGEW91DQOGICAG ICAGICAGICAGIHDPC2GGDG8GDW5ZDWJZY3JPYMUSIHBSZWFZZSBJB250YWN0IEVTUEMGSGVS CCBEZXNRIGF0IDXHDQPJBGFZCZ0IZ21HAWWTBV8TNTUXNTKZMTGYMZC0ODC4OTM4OG1FMJI0 MJU4NJGWMDU1NDE4MDI1MGDTYWLSLW1FOTAZNZMZMDQZNTC0MTG2MTE4BW96LXR4DC1SAW5R LWFIYNJLDMLHDGVKIG0KICAGICAGICAGICAGICAGIGHYZWY9IM1HAWX0BZPFU1BDT3BLCMF0 AW9UC0BUB2FHLMDVDIIGDGFYZ2V0PSJFYMXHBMSIDQOGICAGICAGICAGICAGICAGBW96LWRV LW5VDC1ZZW5KPSJ0CNVLIJ5FU1BDT3BLCMF0AW9UC0BUB2FHLMDVDJWVYT4GB3IGPGENCIAG ICAGICAGICAGICAGICBOCMVMPSJ0ZWW6JTI4MZAXJTI5JTIWODE3LTM4ODAIIHZHBHVLPSIR MTMWMTGXNZM4ODAIDQOGICAGICAGICAGICAGICAGDGFYZ2V0PSJFYMXHBMSIIG1VEI1KBY1U B3QTC2VUZD0IDHJ1ZSI+KDMWMSKGODE3LTM4ODA8L2E+LG0KICAGICAGICAGICAGICBQBGVH C2UGBM90ZTOGAXQGBWF5IHRHA2UGDXAGDG8GDHDVIGJ1C2LUZXNZIGRHEXMGDG8NCIAGICAG ICAGICAGICAGCHJVY2VZCYB5B3VYIHVUC3VIC2NYAWJLIHJLCXVLC3QUPC9WPG0KICAGICAG ICAGIDWVZGL2PG0KICAGICAGICA8L2RPDJ4NCIAGICAGIDWVZGL2PG0KICAGIDWVZGL2PG0K ICA8L2JVZHK+DQO8L2H0BWW+DQO= --BOUNDARY_(ID_FFJDLBDJJLR70ZRT0OWAGW)-- = 
 057 NOUS71 KNES 131914 ADANES SUBJECT: PRODUCT OUTAGE/ANOMALY: UPDATE #1: NOAA 20 CRIS DATA OUTAGE THIS IS A MULTI-PART MESSAGE IN MIME FORMAT. --BOUNDARY_(ID_G6PRIDPG2FBOXJQNPIKOSW) CONTENT-TYPE: TEXT/PLAIN; CHARSET=UTF-8; FORMAT=FLOWED CONTENT-TRANSFER-ENCODING: 8BIT **UPDATE #1: *NOAA 20 HAD A SINGLE UPSET EVENT, A CRIS SSM SEU. IDPS REPORTS AN APPROXIMATE 4 MINUTE UNRECOVERABLE N20 CRIS DATA GAP DUE TO THIS TRANSIENT EVENT.* * * *TOPIC:* NOAA 20 CRIS DATA OUTAGE (UPDATE) *DATE/TIME ISSUED: *JUNE 13, 2019 1908Z * PRODUCT(S) OR DATA IMPACTED:* NOAA 20 CRIS PRODUCTS. * DATE/TIME OF INITIAL IMPACT: *JUNE 13, 2019 1025Z** * DATE/TIME OF EXPECTED END:* JUNE 13, 2019 1029Z* LENGTH OF OUTAGE:* 4 MINS.* DETAILS/SPECIFICS OF CHANGE: *ON JUNE 13, 2019 AT 1030Z THERE WAS A DATA OUTAGE FOR THE CRIS INSTRUMENT. ENGINEERING IS LOOKING INTO THE OUTAGE AT THIS TIME. *CONTACT INFORMATION FOR FURTHER INFORMATION:* ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AT 301-817-3880 *WEB SITE(S) FOR APPLICABLE INFORMATION:* N/A --BOUNDARY_(ID_G6PRIDPG2FBOXJQNPIKOSW) CONTENT-TYPE: TEXT/HTML; CHARSET=UTF-8 CONTENT-TRANSFER-ENCODING: 8BIT
UPDATE #1: NOAA 20 HAD A SINGLE UPSET EVENT, A CRIS SSM SEU. IDPS REPORTS AN APPROXIMATE 4 MINUTE UNRECOVERABLE N20 CRIS DATA GAP DUE TO THIS TRANSIENT EVENT.

TOPIC: NOAA 20 CRIS DATA OUTAGE (UPDATE)

DATE/TIME ISSUED: JUNE 13, 2019 1908Z

PRODUCT(S) OR DATA IMPACTED:
NOAA 20 CRIS PRODUCTS.

DATE/TIME OF INITIAL IMPACT:
JUNE 13, 2019 1025Z


DATE/TIME OF EXPECTED END:
JUNE 13, 2019 1029Z

LENGTH OF OUTAGE:
4 MINS.

DETAILS/SPECIFICS OF CHANGE:
ON JUNE 13, 2019 AT 1030Z THERE WAS A DATA OUTAGE FOR THE CRIS INSTRUMENT. ENGINEERING IS LOOKING INTO THE OUTAGE AT THIS TIME.

CONTACT INFORMATION FOR FURTHER INFORMATION: ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AT 301-817-3880

WEB SITE(S) FOR APPLICABLE INFORMATION: N/A

--BOUNDARY_(ID_G6PRIDPG2FBOXJQNPIKOSW)-- FROM OSPO.ESPC.EXTERNAL.PARTNERS+BNCBCW5BENFXUORB3F7RLUAKGQECHG6V5A@NOAA.GOV THU JUN 13 19:11:42 2019 RETURN-PATH: RECEIVED: FROM MAIL-QT1-F197.GOOGLE.COM (MAIL-QT1-F197.GOOGLE.COM [209.85.160.197]) BY GP5.ESPC.NESDIS.NOAA.GOV (8.14.4/8.14.4) WITH ESMTP ID X5DJBFAE011911 FOR ; THU, 13 JUN 2019 19:11:41 GMT RECEIVED: BY MAIL-QT1-F197.GOOGLE.COM WITH SMTP ID T11SF20137QTC.9 FOR ; THU, 13 JUN 2019 12:11:41 -0700 (PDT) ARC-SEAL: I=2; A=RSA-SHA256; T=1560453101; CV=PASS; D=GOOGLE.COM; S=ARC-20160816; B=LQP8XT0IJ3YZRVIV0HWXUH4VLOIR6+PMCCNRBXSE3DAXUVIGVNCVELOXKQ2J/P+3TV LPUMDHP4FYW9UVG2EP4/YILE+OG+M5SW4K9EOQUG4BZJV19FXCDACBIUXBU7YN4PY6GE 5TS8BACZH8RJ8M4NYTG/SMVHPREJQJ5VHTRWVR5LZUPRGSQRHY8PAK5QDLSITHX+AGJE WIO6X69GYG3PQJAJOPMEMYCABXNEZBSHL/X41VE34RMYXKNZR1NB2KPKHQ7LRA9YT8M8 C9KYA8IQQKCEDLQBGIIMIDVWAZZCJPPI8C7/PYX+GUWZXNVGARB0GGGGIU1DFDIYCRQA YUUA== ARC-MESSAGE-SIGNATURE: I=2; A=RSA-SHA256; C=RELAXED/RELAXED; D=GOOGLE.COM; S=ARC-20160816; H=LIST-ARCHIVE:LIST-HELP:LIST-POST:LIST-ID:MAILING-LIST:PRECEDENCE :USER-AGENT:CONTENT-LANGUAGE:MIME-VERSION:MESSAGE-ID:TO:SUBJECT:FROM :DATE; BH=1CGNPK1REPQ3MTOUVWNUAN7J8ZIQZFZV6SU9QDGAEBQ=; B=RXQF9E6L6UEQ0BDWDMYMSGJEOT8RYEGDXOXBNOHA/7MAGN7SNE/ILNPMHWUARF0L2G CVC5WOUG77G1A2XI/ALUMX4GG8YZ53C6H86WUXNUM3DAUQJQT9CAEJ8UVBDSCM9LNNGQ DEFXAEPMOLRYUDHR5LQJ2CBIWULRSZEIDGXCBJBXKY07LKQOJTGJKBWR56HUL3L/NH8D 6FNP+BOERRU2RYKUMC7EOHOTBGJWLH6UOOWANL/C18CCVZUZJOEXZMK+XS8V73LRI5UI PE7E8ZB1NJQIBWES236UD9SFAGLHHMWKJSV0DITQKZCSIIAUVTPO+BO1JCLX1WGRUGIS +WNQ== ARC-AUTHENTICATION-RESULTS: I=2; MX.GOOGLE.COM; DKIM=PASS HEADER.I=@NOAA.GOV HEADER.S=GOOGLE HEADER.B="FF/Q4YPW"; SPF=PASS (GOOGLE.COM: DOMAIN OF ESPCOPERATIONS@NOAA.GOV DESIGNATES 209.85.220.41 AS PERMITTED SENDER) SMTP.MAILFROM=ESPCOPERATIONS@NOAA.GOV; DMARC=PASS (P=REJECT SP=NONE DIS=NONE) HEADER.FROM=NOAA.GOV X-GOOGLE-DKIM-SIGNATURE: V=1; A=RSA-SHA256; C=RELAXED/RELAXED; D=1E100.NET; S=20161025; H=X-GM-MESSAGE-STATE:DATE:FROM:SUBJECT:TO:MESSAGE-ID:MIME-VERSION :CONTENT-LANGUAGE:USER-AGENT:X-ORIGINAL-SENDER :X-ORIGINAL-AUTHENTICATION-RESULTS:PRECEDENCE:MAILING-LIST:LIST-ID :X-SPAM-CHECKED-IN-GROUP:LIST-POST:LIST-HELP:LIST-ARCHIVE; BH=1CGNPK1REPQ3MTOUVWNUAN7J8ZIQZFZV6SU9QDGAEBQ=; B=QXNQEAEE5UNUR0OLAIXVFXSNGZOXRCBCPFIE3BVA5XNA7NOOWSHHDTW2CS4KTHHJBC 9OFGQKPZOHYSAI2Z2OGWB5WCIDCBNBKSJEIZ4NZVO8GYEPSTYAXTF0HJDLVE2JA76VRX YKIMR0ZUO/A6MY7WO8H9IHCGSLMZFLPW3FCFOT8EYDQUEBA+MWRWA7MLRIUG/I2JAF1P 6JSYVODHSRMIGZPCOCJGPTPSFD/GFOKACRXODBZ3XQFX8+BVI048PS4QNAIHTLOSANW3 ZVXIYV/YSNXUAWOQPHNBKTCT9JH4YCKRYZCHMD/0PBNMZX1OCUBCGNC1124PMYULKAA3 APKA== X-GM-MESSAGE-STATE: APJAAAUZEVFKPTPU1E24U95XKJBSXXD/H08OY+8YAUAEIZZ9TVP0HEGF TLBI0MJWZGM4LGGCU4/TMPUR/BDB X-GOOGLE-SMTP-SOURCE: APXVYQXZO8+RM2H901RMJBRSBPFJEQFTDEQRL1R/XE0WQ6QOFXJC1P3GKMYAH9IPEPI1SQFT8IUDZQ== X-RECEIVED: BY 2002:AC8:2A63:: WITH SMTP ID L32MR57118556QTL.117.1560453101274; THU, 13 JUN 2019 12:11:41 -0700 (PDT) X-BEENTHERE: OSPO.ESPC.EXTERNAL.PARTNERS@NOAA.GOV RECEIVED: BY 2002:AC8:2EBB:: WITH SMTP ID H56LS1768053QTA.16.GMAIL; THU, 13 JUN 2019 12:11:40 -0700 (PDT) X-RECEIVED: BY 2002:AC8:1750:: WITH SMTP ID U16MR59788332QTK.90.1560453100094; THU, 13 JUN 2019 12:11:40 -0700 (PDT) RECEIVED: FROM MTA1.NEMS.NOAA.GOV (MTA1.NEMS.NOAA.GOV. [140.90.121.161]) BY MX.GOOGLE.COM WITH ESMTP ID K3SI339889QTA.267.2019.06.13.12.11.39; THU, 13 JUN 2019 12:11:40 -0700 (PDT) RECEIVED-SPF: PASS (GOOGLE.COM: DOMAIN OF ESPCOPERATIONS@NOAA.GOV DESIGNATES 140.90.121.161 AS PERMITTED SENDER) CLIENT-IP=140.90.121.161; RECEIVED: FROM MAIL-QK1-F200.GOOGLE.COM ([209.85.222.200]) BY MTA.NEMS.NOAA.GOV (SUN JAVA SYSTEM MESSAGING SERVER 6.2-7.05 (BUILT SEP 5 2006)) ID <0PT100H01X348V00@MTA.NEMS.NOAA.GOV> (ORIGINAL MAIL FROM ESPCOPERATIONS@NOAA.GOV) (ORCPT ESPC.NOTIFICATION@NOAA.GOV); THU, 13 JUN 2019 15:11:39 -0400 (EDT) RECEIVED: FROM MAIL-QK1-F200.GOOGLE.COM ([209.85.222.200]) BY MTA.NEMS.NOAA.GOV (SUN JAVA SYSTEM MESSAGING SERVER 6.2-7.05 (BUILT SEP 5 2006)) WITH ESMTPS ID <0PT1006ZKXBFQL00@MTA.NEMS.NOAA.GOV> FOR ESPC.NOTIFICATION@NOAA.GOV; THU, 13 JUN 2019 15:11:39 -0400 (EDT) RECEIVED: BY MAIL-QK1-F200.GOOGLE.COM WITH SMTP ID N190SO17534128QKD.5 FOR ; THU, 13 JUN 2019 12:11:39 -0700 (PDT) RECEIVED: FROM MAIL-SOR-F41.GOOGLE.COM (MAIL-SOR-F41.GOOGLE.COM. [209.85.220.41]) BY MX.GOOGLE.COM WITH SMTPS ID S133SOR579771QKE.91.2019.06.13.12.11.38 FOR (GOOGLE TRANSPORT SECURITY); THU, 13 JUN 2019 12:11:38 -0700 (PDT) RECEIVED: FROM [10.144.3.180] ([140.90.213.33]) BY SMTP.GMAIL.COM WITH ESMTPSA ID G188SM215435QKC.52.2019.06.13.12.11.36 FOR (VERSION=TLS1_2 CIPHER=ECDHE-RSA-AES128-GCM-SHA256 BITS=128/128); THU, 13 JUN 2019 12:11:37 -0700 (PDT) X-RECEIVED: BY 2002:AE9:C20A:: WITH SMTP ID J10MR72966028QKG.360.1560453099409; THU, 13 JUN 2019 12:11:39 -0700 (PDT) X-RECEIVED: BY 2002:AE9:C20A:: WITH SMTP ID J10MR72965978QKG.360.1560453098786; THU, 13 JUN 2019 12:11:38 -0700 (PDT) X-RECEIVED: BY 2002:AE9:D601:: WITH SMTP ID R1MR73226767QKK.231.1560453097860; THU, 13 JUN 2019 12:11:37 -0700 (PDT) DATE: THU, 13 JUN 2019 19:11:36 +0000 FROM: ESPCOPERATIONS =  218 NOUS71 KNES 131914 ADANES SUBJECT: PRODUCT OUTAGE/ANOMALY: UPDATE #1: DMSP SSMI/S DATA DELAY THIS IS A MULTI-PART MESSAGE IN MIME FORMAT. --BOUNDARY_(ID_W3IOTLWF85NSJVSIDWOSFW) CONTENT-TYPE: TEXT/PLAIN; CHARSET=UTF-8; FORMAT=FLOWED CONTENT-TRANSFER-ENCODING: 7BIT *UPDATE #1:* AFTER A RESHIP, F-17 REV 65048 AND F-18 REV 49778 WERE NOT RECEIVED AT ESPC. THE DATA IS CONSIDERED LOST. *TOPIC:*DMSP SSMI/S DATA DELAY *DATE/TIME ISSUED: *JUNE 13, 2019 1911Z ** *PRODUCT(S) OR DATA IMPACTED:*F-17 REV 65048, F-18 REV 49778 *DATE/TIME OF INITIAL IMPACT: *JUNE 13, 2019 1627Z *DATE/TIME OF EXPECTED END: *TBD ** *LENGTH OF OUTAGE:*TBD *DETAILS/SPECIFICS OF CHANGE:*ESPC DID NOT RECEIVE DMSP SSMI/S F-17 REV 65048 AND F-18 REV 49778 FROM MONTEREY/FNMOC. ESPC CALLED MONTEREY/FNMOC AND REQUESTED A RESHIP OF THE DATA. *CONTACT INFORMATION FOR FURTHER INFORMATION:* ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AT 301-817-3880 ** *WEB SITE(S) FOR APPLICABLE INFORMATION:*N/A THIS MESSAGE WAS SENT BY ESPC.NOTIFICATION@NOAA.GOV . YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880 . PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST. _ --BOUNDARY_(ID_W3IOTLWF85NSJVSIDWOSFW) CONTENT-TYPE: TEXT/HTML; CHARSET=UTF-8 CONTENT-TRANSFER-ENCODING: 8BIT

UPDATE #1: AFTER A RESHIP, F-17 REV 65048 AND F-18 REV 49778 WERE NOT RECEIVED AT ESPC. THE DATA IS CONSIDERED LOST.

TOPIC: DMSP SSMI/S DATA DELAY

DATE/TIME ISSUED: JUNE 13, 2019 1911Z


PRODUCT(S) OR DATA IMPACTED: F-17 REV 65048, F-18 REV 49778

DATE/TIME OF INITIAL IMPACT: JUNE 13, 2019 1627Z

DATE/TIME OF EXPECTED END: TBD

LENGTH OF OUTAGE: TBD

DETAILS/SPECIFICS OF CHANGE: ESPC DID NOT RECEIVE DMSP SSMI/S F-17 REV 65048 AND F-18 REV 49778 FROM MONTEREY/FNMOC. ESPC CALLED MONTEREY/FNMOC AND REQUESTED A RESHIP OF THE DATA.


CONTACT INFORMATION FOR FURTHER INFORMATION: ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AT 301-817-3880


WEB SITE(S) FOR APPLICABLE INFORMATION: N/A

THIS MESSAGE WAS SENT BY ESPC.NOTIFICATION@NOAA.GOV. YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880. PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST.

--BOUNDARY_(ID_W3IOTLWF85NSJVSIDWOSFW)-- =  458 NOUS71 KNES 131924 ADANES SUBJECT: PRODUCT OUTAGE/ANOMALY: METOP HRPT DATA LOSS - ISSUED: THIS IS A MULTI-PART MESSAGE IN MIME FORMAT. --BOUNDARY_(ID_NZZRLDGBJ0+9PDQWQ3HLTA) CONTENT-TYPE: TEXT/PLAIN; CHARSET=UTF-8; FORMAT=FLOWED CONTENT-TRANSFER-ENCODING: 8BIT *TOPIC:* METOP HRPT DATA LOSS *DATE/TIME ISSUED: *JUNE 13, 2019 1922Z *PRODUCT(S) OR DATA IMPACTED:*METOP-1 HRPT REV. 34950, METOP-2 HRPT REV. 65636, METOP-3 HRPT REV. 03107 *DATE/TIME OF INITIAL IMPACT: *JUNE 13, 2019 1645Z* ** **DATE/TIME OF EXPECTED END:* N/A ** *LENGTH OF OUTAGE:* N/A *DETAILS/SPECIFICS OF CHANGE: ***ESPC DID NOT RECEIVE METOP-1 HRPT REV. 34950, METOP-2 HRPT REV. 65636, AND METOP-3 HRPT REV. 03107. THE LOSS WAS DUE TO AN ANTENNA ISSUE. *CONTACT INFORMATION FOR FURTHER INFORMATION:* ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AT 301-817-3880 *WEB SITE(S) FOR APPLICABLE INFORMATION:* N/A THIS MESSAGE WAS SENT BY ESPC.NOTIFICATION@NOAA.GOV. YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880. PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST. --BOUNDARY_(ID_NZZRLDGBJ0+9PDQWQ3HLTA) CONTENT-TYPE: TEXT/HTML; CHARSET=UTF-8 CONTENT-TRANSFER-ENCODING: 8BIT TOPIC: METOP HRPT DATA LOSS

DATE/TIME ISSUED: JUNE 13, 2019 1922Z

PRODUCT(S) OR DATA IMPACTED: METOP-1 HRPT REV. 34950, METOP-2 HRPT REV. 65636, METOP-3 HRPT REV. 03107

DATE/TIME OF INITIAL IMPACT: JUNE 13, 2019 1645Z

DATE/TIME OF EXPECTED END: N/A

LENGTH OF OUTAGE: N/A

DETAILS/SPECIFICS OF CHANGE: ESPC DID NOT RECEIVE METOP-1 HRPT REV. 34950, METOP-2 HRPT REV. 65636, AND METOP-3 HRPT REV. 03107. THE LOSS WAS DUE TO AN ANTENNA ISSUE.

CONTACT INFORMATION FOR FURTHER INFORMATION: ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AT 301-817-3880

WEB SITE(S) FOR APPLICABLE INFORMATION: N/A

THIS MESSAGE WAS SENT BY ESPC.NOTIFICATION@NOAA.GOV. YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880. PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST.

--BOUNDARY_(ID_NZZRLDGBJ0+9PDQWQ3HLTA)-- = 
 460 NOUS71 KNES 131814 ADANES SUBJECT: PRODUCT OUTAGE/ANOMALY: DMSP SSMI/S DATA DELAY - ISSUED: THIS IS A MULTI-PART MESSAGE IN MIME FORMAT. --BOUNDARY_(ID_L0KLRGXXWOPYRFQAV+SMUA) CONTENT-TYPE: TEXT/PLAIN; CHARSET=UTF-8; FORMAT=FLOWED CONTENT-TRANSFER-ENCODING: 8BIT *TOPIC:*DMSP SSMI/S DATA DELAY *DATE/TIME ISSUED: *JUNE 13, 2019 1805Z ** *PRODUCT(S) OR DATA IMPACTED: *F-17 REV 65048, F-18 REV 49778 *DATE/TIME OF INITIAL IMPACT: *JUNE 13, 2019 1627Z *DATE/TIME OF EXPECTED END: *TBD ** *LENGTH OF OUTAGE:* TBD *DETAILS/SPECIFICS OF CHANGE:*ESPC DID NOT RECEIVE DMSP SSMI/S F-17 REV 65048 AND F-18 REV 49778 FROM MONTEREY/FNMOC. ESPC CALLED MONTEREY/FNMOC AND REQUESTED A RESHIP OF THE DATA. *CONTACT INFORMATION FOR FURTHER INFORMATION:* ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AT 301-817-3880 ** *WEB SITE(S) FOR APPLICABLE INFORMATION:*N/A THIS MESSAGE WAS SENT BY ESPC.NOTIFICATION@NOAA.GOV . YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880 . PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST. _ --BOUNDARY_(ID_L0KLRGXXWOPYRFQAV+SMUA) CONTENT-TYPE: TEXT/HTML; CHARSET=UTF-8 CONTENT-TRANSFER-ENCODING: 8BIT

TOPIC: DMSP SSMI/S DATA DELAY

DATE/TIME ISSUED: JUNE 13, 2019 1805Z


PRODUCT(S) OR DATA IMPACTED: F-17 REV 65048, F-18 REV 49778

DATE/TIME OF INITIAL IMPACT: JUNE 13, 2019 1627Z

DATE/TIME OF EXPECTED END: TBD

LENGTH OF OUTAGE: TBD

DETAILS/SPECIFICS OF CHANGE: ESPC DID NOT RECEIVE DMSP SSMI/S F-17 REV 65048 AND F-18 REV 49778 FROM MONTEREY/FNMOC. ESPC CALLED MONTEREY/FNMOC AND REQUESTED A RESHIP OF THE DATA.


CONTACT INFORMATION FOR FURTHER INFORMATION: ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AT 301-817-3880


WEB SITE(S) FOR APPLICABLE INFORMATION: N/A

THIS MESSAGE WAS SENT BY ESPC.NOTIFICATION@NOAA.GOV. YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880. PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST.

--BOUNDARY_(ID_L0KLRGXXWOPYRFQAV+SMUA)-- = 
 716 NOUS71 KNES 131754 ADANES SUBJECT: PRODUCT OUTAGE/ANOMALY: NOAA 20 CRIS DATA OUTAGE - ISSUED: THIS IS A MULTI-PART MESSAGE IN MIME FORMAT. --BOUNDARY_(ID_OFDJQPBGDJYLAHQ8IHRHBA) CONTENT-TYPE: TEXT/PLAIN; CHARSET=UTF-8; FORMAT=FLOWED CONTENT-TRANSFER-ENCODING: 8BIT *TOPIC:*NOAA 20 CRIS DATA OUTAGE *DATE/TIME ISSUED: *//JUNE 13, 2019 1744Z * PRODUCT(S) OR DATA IMPACTED:* NOAA 20 CRIS PRODUCTS. * DATE/TIME OF INITIAL IMPACT: *JUNE 13, 2019 1025Z * DATE/TIME OF EXPECTED END:* TBD* LENGTH OF OUTAGE:* TBD* DETAILS/SPECIFICS OF CHANGE: *ON JUNE 13, 2019 AT 1030Z THERE WAS A DATA OUTAGE FOR THE CRIS INSTRUMENT. ENGINEERING IS IS LOOKING INTO THE OUTAGE AT THIS TIME. *CONTACT INFORMATION FOR FURTHER INFORMATION:* ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AT 301-817-3880 *WEB SITE(S) FOR APPLICABLE INFORMATION:* N/A ** THIS MESSAGE WAS SENT BY ESPC.NOTIFICATION@NOAA.GOV. YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880. PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST. --BOUNDARY_(ID_OFDJQPBGDJYLAHQ8IHRHBA) CONTENT-TYPE: TEXT/HTML; CHARSET=UTF-8 CONTENT-TRANSFER-ENCODING: 8BIT
TOPIC:DATE/TIME ISSUED: JUNE 13, 2019 1744Z

PRODUCT(S) OR DATA IMPACTED:
NOAA 20 CRIS PRODUCTS.

DATE/TIME OF INITIAL IMPACT:
JUNE 13, 2019 1025Z


DATE/TIME OF EXPECTED END:
TBD


LENGTH OF OUTAGE:
TBD

DETAILS/SPECIFICS OF CHANGE:
ON JUNE 13, 2019 AT 1030Z THERE WAS A DATA OUTAGE FOR THE CRIS INSTRUMENT. ENGINEERING IS IS LOOKING INTO THE OUTAGE AT THIS TIME.

CONTACT INFORMATION FOR FURTHER INFORMATION: ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AT 301-817-3880

WEB SITE(S) FOR APPLICABLE INFORMATION: N/A

THIS MESSAGE WAS SENT BY ESPC.NOTIFICATION@NOAA.GOV. YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880. PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST.

--BOUNDARY_(ID_OFDJQPBGDJYLAHQ8IHRHBA)-- = 
 558 NOUS74 KEHU 131542 ADASRH Alert Administrative Message National Weather Service Southern Region Headquarters 1042 AM CDT Thu Jun 13 2019 To: All Southern Region Offices From: WFO MOB Subject: WFO MOB is resuming normal operations WFO MOB has returned to service following backup due to an AWIPS upgrade. Special thanks to WFO LIX for providing service backup. $$ 
 534 NOUS74 KEHU 131430 ADASRH Alert Administrative Message National Weather Service Southern Region Headquarters 930 AM CDT Thu Jun 13 2019 To: All Southern Region Offices From: WFO LIX Subject: WFO LIX providing Service Backup for WFO MOB WFO LIX has assumed full service backup for WFO MOB due to an AWIPS upgrade. Anticipate restoral to service by 1030 am CDT. $$ 24/RR 
 671 NOUS71 KNES 131124 ADANES SUBJECT: PRODUCT OUTAGE/ANOMALY: (UPDATE #2) COSMIC DATA OUTAGE - THIS IS A MULTI-PART MESSAGE IN MIME FORMAT. --BOUNDARY_(ID_ML+8KQYXYU4FRO+VGBKUPQ) CONTENT-TYPE: TEXT/PLAIN; CHARSET=WINDOWS-1252; FORMAT=FLOWED CONTENT-TRANSFER-ENCODING: 8BIT *UPDATE #2 (FINAL UPDATE): *COSMIC DATA HAS RESUMED AT ESPC. * * *UPDATE #1: *ESPC RECIEVED A MESSAGE FROM THE COSMIC TEAM STATING - "WE ARE HAVING AN OUTAGE DUE TO COSMIC SATELLITES' STATE OF HEALTH. WE HOPE DATA WILL RESUME SHORTLY. AT THIS POINT WE DO NOT HAVE AN ETA."* TOPIC:* **COSMIC DATA OUTAGE *DATE/TIME ISSUED**:*JUNE 13, 2019 1119Z *PRODUCT(S) OR DATA IMPACTED*: COSMIC DATA *DATE/TIME OF INITIAL IMPACT*:JUNE 04, 2019 1909Z *DATE/TIME OF EXPECTED END**: *JUNE 13, 2019 1112Z *LENGTH OF EVENT: *APPROX. 8 DAYS, 16 HOURS *DETAILS/SPECIFICS OF CHANGE:*ESPC IS NOT RECEIVING COSMIC DATA. THE DATA PROVIDER WAS CONTACTED. *CONTACT INFORMATION FOR FURTHER INFORMATION:* ESPCOPERATIONS@NOAA.GOV AND 301-817-3880 *WEB SITE(S) FOR APPLICABLE INFORMATION:*N/A THIS MESSAGE WAS SENT FROM ESPC.NOTIFICATION@NOAA.GOV . YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880 . PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST. --BOUNDARY_(ID_ML+8KQYXYU4FRO+VGBKUPQ) CONTENT-TYPE: TEXT/HTML; CHARSET=WINDOWS-1252 CONTENT-TRANSFER-ENCODING: 8BIT
UPDATE #2 (FINAL UPDATE): COSMIC DATA HAS RESUMED AT ESPC.

UPDATE #1: ESPC RECIEVED A MESSAGE FROM THE COSMIC TEAM STATING - "WE ARE HAVING AN OUTAGE DUE TO COSMIC SATELLITES' STATE OF HEALTH. WE HOPE DATA WILL RESUME SHORTLY. AT THIS POINT WE DO NOT HAVE AN ETA."

TOPIC:
COSMIC DATA OUTAGE

DATE/TIME ISSUED: JUNE 13, 2019 1119Z

PRODUCT(S) OR DATA IMPACTED: COSMIC DATA

DATE/TIME OF INITIAL IMPACT: JUNE 04, 2019 1909Z

DATE/TIME OF EXPECTED END: JUNE 13, 2019 1112Z

LENGTH OF EVENT: APPROX. 8 DAYS, 16 HOURS

DETAILS/SPECIFICS OF CHANGE: ESPC IS NOT RECEIVING COSMIC DATA. THE DATA PROVIDER WAS CONTACTED.

CONTACT INFORMATION FOR FURTHER INFORMATION: HREF="MAILTO:ESPCOPERATIONS@NOAA.GOV" TARGET="_BLANK" MOZ-DO-NOT-SEND="TRUE">ESPCOPERATIONS@NOAA.GOV AND 301-817-3880

WEB SITE(S) FOR APPLICABLE INFORMATION: N/A

THIS MESSAGE WAS SENT FROM ESPC.NOTIFICATION@NOAA.GOV. YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880. PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST.

--BOUNDARY_(ID_ML+8KQYXYU4FRO+VGBKUPQ)-- =  302 NOUS71 KNES 131134 ADANES SUBJECT: PRODUCT ANOMALY: INTERMITTENT DEGRADATION OF GOES-16 MESO-2 THIS IS A MULTI-PART MESSAGE IN MIME FORMAT. --BOUNDARY_(ID_VWLBVJ8JY4RBEIBJG4A20A) CONTENT-TYPE: TEXT/PLAIN; CHARSET=UTF-8; FORMAT=FLOWED CONTENT-TRANSFER-ENCODING: 8BIT *TOPIC: *INTERMITTENT DEGRADATION OF GOES-16 MESO-2 SOUNDING PRODUCTS AND THEIR DISTRIBUTION TO PDA. *DATE/TIME ISSUED:* JUNE13, 2019 1125Z *PRODUCT(S) OR DATA IMPACTED:* INTERMITTENT DEGRADATION OF GOES-16 MESO-2 SOUNDING PRODUCTS (LEGACY VERTICAL TEMPERATURE, LEGACY VERTICAL MOISTURE, TOTAL PRECIPITABLE WATER) AND THEIR DISTRIBUTION TO PDA. *DATE/TIME OF INITIAL IMPACT: *JUNE 12, 2019 2115Z *DATE/TIME OF EXPECTED END:* TBD *LENGTH OF EVENT:* TBD *DETAILS/SPECIFICS OF CHANGE:* INTERMITTENT DEGRADATION OF GOES-16 MESO-2 SOUNDING PRODUCTS (LEGACY VERTICAL TEMPERATURE, LEGACY VERTICAL MOISTURE, TOTAL PRECIPITABLE WATER) AND THEIR DISTRIBUTION TO PDA DUE TO AN ANOMALY. ** ** *CONTACT INFORMATION FOR FURTHER INFORMATION: *ROSS.COX@NOAA.GOV *WEB SITE(S) FOR APPLICABLE INFORMATION:*N/A THIS MESSAGE WAS SENT FROM ESPC.NOTIFICATION@NOAA.GOV . YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880 . PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST. --BOUNDARY_(ID_VWLBVJ8JY4RBEIBJG4A20A) CONTENT-TYPE: TEXT/HTML; CHARSET=UTF-8 CONTENT-TRANSFER-ENCODING: BASE64 PGH0BWW+DQOGIDXOZWFKPG0KICAGIDXTZXRHIGH0DHATZXF1AXY9IMNVBNRLBNQTDHLWZSIG Y29UDGVUDD0IDGV4DC9ODG1SOYBJAGFYC2V0PVVURI04IJ4NCIAGPC9OZWFKPG0KICA8YM9K ESB0ZXH0PSIJMDAWMDAWIIBIZ2NVBG9YPSIJRKZGRKZGIJ4NCIAGICA8ZGL2IGRPCJ0IBHRY IJ4NCIAGICAGIDXKAXYGZGLYPSJSDHIIPG0KICAGICAGICA8ZGL2IHN0EWXLPSJMB250OJQW MCAXMY4ZM3B4LZE5LJK5CHGNCKFYAWFSLEHLBHZLDGLJYSXZYW5ZLXNLCMLMO3RLEHQTYWXP Z246BGVMDDTJB2XVCJPYZ2IOMZQSMZQSMZQPO3RLEHQTDHJHBNNMB3JTOM5VBMU7DGV4DC1P BMRLBNQ6MHB4O2XLDHRLCI1ZCGFJAW5NOM5VCM1HBDTVDMVYZMXVDZP2AXNPYMXLO3RLEHQT ZGVJB3JHDGLVBJPUB25LO3DVCMQTC3BHY2LUZZOWCHG7D2HPDGUTC3BHY2U6BM9YBWFSO2ZV BNQTC2L6ZS1HZGP1C3Q6BM9UZTTMB250LXN0CMV0Y2G6MTAWJTTIYWNRZ3JVDW5KLWNVBG9Y ONRYYW5ZCGFYZW50IJ48YJ5UB3BPYZONCIAGICAGICAGICA8L2I+SW50ZXJTAXR0ZW50IGRL Z3JHZGF0AW9UIG9MIEDPRVMTMTYGTWVZBY0YIDXZCGFUDQOGICAGICAGICAGICBJBGFZCZ0I Z21HAWWTAWWIPLNVDW5KAW5NPC9ZCGFUPIBWCM9KDWN0CYBHBMQGDGHLAXINCIAGICAGICAG ICBKAXN0CMLIDXRPB24GDG8GUERBLJWVZGL2PG0KICAGICAGICA8ZGL2IHN0EWXLPSJMB250 OJQWMCAXMY4ZM3B4LZE5LJK5CHGNCKFYAWFSLEHLBHZLDGLJYSXZYW5ZLXNLCMLMO3RLEHQT YWXPZ246BGVMDDTJB2XVCJPYZ2IOMZQSMZQSMZQPO3RLEHQTDHJHBNNMB3JTOM5VBMU7DGV4 DC1PBMRLBNQ6MHB4O2XLDHRLCI1ZCGFJAW5NOM5VCM1HBDTVDMVYZMXVDZP2AXNPYMXLO3RL EHQTZGVJB3JHDGLVBJPUB25LO3DVCMQTC3BHY2LUZZOWCHG7D2HPDGUTC3BHY2U6BM9YBWFS O2ZVBNQTC2L6ZS1HZGP1C3Q6BM9UZTTMB250LXN0CMV0Y2G6MTAWJTTIYWNRZ3JVDW5KLWNV BG9YONRYYW5ZCGFYZW50IJ48YNINCNN0EWXLPSJSAW5LLWHLAWDODDOXOS45OXB4O292ZXJM BG93ONZPC2LIBGU7ZM9UDC1ZAXPLOJEZLJMZCHG7ZM9UDC1ZDHLSZTPUB3JTYWW7ZM9UDC12 YXJPYW50OM5VCM1HBDTMB250LXDLAWDODDO0MDA7ZM9UDC1ZAXPLLWFKANVZDDPUB25LO2ZV BNQTC3RYZXRJADOXMDALIJ4NCIAGICAGICAGICA8C3RYB25NDQPZDHLSZT0IBGLUZS1OZWLN AHQ6MTKUOTLWEDTVDMVYZMXVDZP2AXNPYMXLO2ZVBNQTC2L6ZTOXMY4ZM3B4O2ZVBNQTC3R5 BGU6BM9YBWFSO2ZVBNQTDMFYAWFUDDPUB3JTYWW7ZM9UDC13ZWLNAHQ6NZAWO2ZVBNQTC2L6 ZS1HZGP1C3Q6BM9UZTTMB250LXN0CMV0Y2G6MTAWJSI+RGF0ZS9UAW1LDQOGICAGICAGICAG ICBJC3N1ZWQ6PC9ZDHJVBMC+WQAGSNVUZTXZCGFUDQPJBGFZCZ0IZ21HAWWTBV8TNDYWMTI1 NTQ2NDYZOTG3NZUWOWDTYWLSLW1FLTI3MJQ4MTUZMJMXODY1NTUYOGDTYWLSLW1FLTG5NTE4 MTQXOTGWNZU0MZM1ODHNBWFPBC1TXY0ZNTM3NZIYNDEZMJG3MDE0MJI4Z21HAWWTBV8XMZY3 NZI2OTU2NJG1NDU4NDY5Z21HAWWTBV81MZE3NJYWNDKXMTIXMDA5NTG5Z21HAWWTBV82ODI3 OTG0MTK5NDUWMDA2MDNNBWFPBC1TXZQZMTQ5OTCWOTK0MTA1NDY1MZZNBWFPBC1TXZM3NJIX NJU3MJU5MTGWOTYZMJLNBWFPBC1TXZQWNZEZNJU1MZI1NJMXNZUYNTLNBWFPBC1TXY04MJYW OTY5MDA3NDK1MTG4MJA3Z21HAWWTBV8TNTAZMTKWODU3NDC1NJEZOTC1Z21HAWWTBV8TMTMX OTA0MTKWNTM2MDG2NTQWOGDTYWLSLW1FODC5NZC1OTC1MZC3NDC3NJLNBWFPBC1TXZUXNTE4 MJYWOTEYNJI0NTU0MTLNBWFPBC1TXZM2NTY5MTMXNTA4NJU5NJG4NMDTYWLSLW1FMTM3NDC4 MJE5ODKXNDQXNZYYNMDTYWLSLW1FNZK0MTE5ODY3ODEYNZMXMJGYNGDTYWLSLW1FNDIXMZY5 MDM1MDE0MJI2NDK5N2DTYWLSLW1FNDGYMJEXNTK0MDMZNTY4MJU4MGDTYWLSLW1FNZQ1NDGX MDCWOTKYNTM5MTG5N2DTYWLSLW1FLTU4MZCZNDUWNZG0OTU1NTGYODNNBWFPBC1TXY04NJK0 MTU4OTK5NTA5MTYXNJG0Z21HAWWTBV81NZYYOTAWNZKYNZA2ODCZMZK0Z21HAWWTBV81NDA5 ODEXMJU4MJI0NJA2MZI4Z21HAWWTBV8XODA2MTQXMZCZOTGWNJGWMDAWZ21HAWWTBV8YNDMW MDE3MTE2ODQ5NJI1MDE4Z21HAWWTBV84NDI2NDE3MDM5MTY2NDCYNZG0Z21HAWWTBV81NJA2 MZKXNJCXMDIYODY2NDLNBWFPBC1TXY0XODA0NJG4NJUZNJCYNZK2NZK4Z21HAWWTBV8TNDA1 MDC4NJY1MDA5NJEXMJU1NGDTYWLSLW1FLTIZMTA5NZK5MDI4MZQ3MZY3NDNNBWFPBC1TXZU1 NJY0NZQ1MDKWNJYXNDG2MZNNBWFPBC1TXY0YOTA5NJMZOTAYODKZNZG1MJY1Z21HAWWTBV83 MZKXMDY0NZQXMTG5MTY0MDMXZ21HAWWTBV8TNZMZMDQ4MZK3NZAYNTEZODKYZ21HAWWTBV8T NTK4OTMYNZQ0MDG2NZG3MJC0MGDTYWLSLW1FLTQWNTIWMZK2MTK0OTKXODKYNTJNBWFPBC1T XZK4NJEWMZIZMZIXNDE3MJC2M2DTYWLSLW1FODAXNDA5MZGXODE2NTE0MTVNBWFPBC1TXZGW NDMXMZY0NJA0NJA0MDM3N2DTYWLSLW1FLTC0NJU0MJQ1OTU3NJGZMJYYNDHNBWFPBC1TXY03 MDK1OTY4OTY0NDM4ODCXMJQ2Z21HAWWTYUJUIG0KC3R5BGU9IMXPBMUTAGVPZ2H0OJE5LJK5 CHG7B3ZLCMZSB3C6DMLZAWJSZTTMB250LXNPEMU6MTMUMZNWEDTMB250LXN0EWXLOM5VCM1H BDTMB250LXZHCMLHBNQ6BM9YBWFSO2ZVBNQTD2VPZ2H0OJQWMDTMB250LXNPEMUTYWRQDXN0 OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCUIPJXZCGFUDQPJBGFZCZ0IZ21HAWWTBV8TNDYWMTI1 NTQ2NDYZOTG3NZUWOWDTYWLSLW1FLTI3MJQ4MTUZMJMXODY1NTUYOGDTYWLSLW1FLTG5NTE4 MTQXOTGWNZU0MZM1ODHNBWFPBC1TXY0ZNTM3NZIYNDEZMJG3MDE0MJI4Z21HAWWTBV8XMZY3 NZI2OTU2NJG1NDU4NDY5Z21HAWWTBV81MZE3NJYWNDKXMTIXMDA5NTG5Z21HAWWTBV82ODI3 OTG0MTK5NDUWMDA2MDNNBWFPBC1TXZQZMTQ5OTCWOTK0MTA1NDY1MZZNBWFPBC1TXZM3NJIX NJU3MJU5MTGWOTYZMJLNBWFPBC1TXZQWNZEZNJU1MZI1NJMXNZUYNTLNBWFPBC1TXY04MJYW OTY5MDA3NDK1MTG4MJA3Z21HAWWTBV8TNTAZMTKWODU3NDC1NJEZOTC1Z21HAWWTBV8TMTMX OTA0MTKWNTM2MDG2NTQWOGDTYWLSLW1FODC5NZC1OTC1MZC3NDC3NJLNBWFPBC1TXZUXNTE4 MJYWOTEYNJI0NTU0MTLNBWFPBC1TXZM2NTY5MTMXNTA4NJU5NJG4NMDTYWLSLW1FMTM3NDC4 MJE5ODKXNDQXNZYYNMDTYWLSLW1FNZK0MTE5ODY3ODEYNZMXMJGYNGDTYWLSLW1FNDIXMZY5 MDM1MDE0MJI2NDK5N2DTYWLSLW1FNDGYMJEXNTK0MDMZNTY4MJU4MGDTYWLSLW1FNZQ1NDGX MDCWOTKYNTM5MTG5N2DTYWLSLW1FLTU4MZCZNDUWNZG0OTU1NTGYODNNBWFPBC1TXY04NJK0 MTU4OTK5NTA5MTYXNJG0Z21HAWWTBV81NZYYOTAWNZKYNZA2ODCZMZK0Z21HAWWTBV81NDA5 ODEXMJU4MJI0NJA2MZI4Z21HAWWTBV8XODA2MTQXMZCZOTGWNJGWMDAWZ21HAWWTBV8YNDMW MDE3MTE2ODQ5NJI1MDE4Z21HAWWTBV84NDI2NDE3MDM5MTY2NDCYNZG0Z21HAWWTBV81NJA2 MZKXNJCXMDIYODY2NDLNBWFPBC1TXY0XODA0NJG4NJUZNJCYNZK2NZK4Z21HAWWTBV8TNDA1 MDC4NJY1MDA5NJEXMJU1NGDTYWLSLW1FLTIZMTA5NZK5MDI4MZQ3MZY3NDNNBWFPBC1TXZU1 NJY0NZQ1MDKWNJYXNDG2MZNNBWFPBC1TXY0YOTA5NJMZOTAYODKZNZG1MJY1Z21HAWWTBV83 MZKXMDY0NZQXMTG5MTY0MDMXZ21HAWWTBV8TNZMZMDQ4MZK3NZAYNTEZODKYZ21HAWWTBV8T NTK4OTMYNZQ0MDG2NZG3MJC0MGDTYWLSLW1FLTQWNTIWMZK2MTK0OTKXODKYNTJNBWFPBC1T XZK4NJEWMZIZMZIXNDE3MJC2M2DTYWLSLW1FODAXNDA5MZGXODE2NTE0MTVNBWFPBC1TXZGW NDMXMZY0NJA0NJA0MDM3N2DTYWLSLW1FLTC0NJU0MJQ1OTU3NJGZMJYYNDHNBWFPBC1TXY03 MDK1OTY4OTY0NDM4ODCXMJQ2Z21HAWWTYVFKIG0KC3R5BGU9IMXPBMUTAGVPZ2H0OJE5LJK5 CHG7B3ZLCMZSB3C6DMLZAWJSZTTMB250LXNPEMU6MTMUMZNWEDTMB250LXN0EWXLOM5VCM1H BDTMB250LXZHCMLHBNQ6BM9YBWFSO2ZVBNQTD2VPZ2H0OJQWMDTMB250LXNPEMUTYWRQDXN0 OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCUIPG0KICAGICAGICAGICAGICAXMYWGMJAXOSAXMTI1 WJWVC3BHBJ48L3NWYW4+PC9KAXY+DQOGICAGICAGIDXKAXYGC3R5BGU9IMZVBNQ6NDAWIDEZ LJMZCHGVMTKUOTLWEA0KQXJPYWWSSGVSDMV0AWNHLHNHBNMTC2VYAWY7DGV4DC1HBGLNBJPS ZWZ0O2NVBG9YONJNYIGZNCWZNCWZNCK7DGV4DC10CMFUC2ZVCM06BM9UZTT0ZXH0LWLUZGVU DDOWCHG7BGV0DGVYLXNWYWNPBMC6BM9YBWFSO292ZXJMBG93ONZPC2LIBGU7DGV4DC1KZWNV CMF0AW9UOM5VBMU7D29YZC1ZCGFJAW5NOJBWEDT3AGL0ZS1ZCGFJZTPUB3JTYWW7ZM9UDC1Z AXPLLWFKANVZDDPUB25LO2ZVBNQTC3RYZXRJADOXMDALO2JHY2TNCM91BMQTY29SB3I6DHJH BNNWYXJLBNQIPJXICG0KC3R5BGU9IMXPBMUTAGVPZ2H0OJE5LJK5CHG7B3ZLCMZSB3C6DMLZ AWJSZTTMB250LXNPEMU6MTMUMZNWEDTMB250LXN0EWXLOM5VCM1HBDTMB250LXZHCMLHBNQ6 BM9YBWFSO2ZVBNQTD2VPZ2H0OJQWMDTMB250LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1ZDHJL DGNOOJEWMCUIPG0KICAGICAGICAGIDXIPLBYB2R1Y3QOCYKGB3IGRGF0YSBJBXBHY3RLZDO8 L2I+IELUDGVYBWL0DGVUDCBKZWDYYWRHDGLVBG0KICAGICAGICAGIG9MWQA8C3BHBG0KC3R5 BGU9INRLEHQTYWXPZ246BGVMDDTJB2XVCJPYZ2IOMZQSMZQSMZQPO3RLEHQTDHJHBNNMB3JT OM5VBMU7BGLUZS1OZWLNAHQ6MTKUOTLWEDT0ZXH0LWLUZGVUDDOWCHG7BGV0DGVYLXNWYWNP BMC6BM9YBWFSO2ZVBNQTC2L6ZTOXMY4ZM3B4O2ZVBNQTC3R5BGU6BM9YBWFSO2ZVBNQTDMFY AWFUDDPUB3JTYWW7ZM9UDC13ZWLNAHQ6NDAWO3RLEHQTZGVJB3JHDGLVBJPUB25LO3DVCMQT C3BHY2LUZZOWCHG7ZGLZCGXHETPPBMXPBMU7D2HPDGUTC3BHY2U6BM9YBWFSO2ZVBNQTC2L6 ZS1HZGP1C3Q6BM9UZTTMB250LXN0CMV0Y2G6MTAWJTTMBG9HDDPUB25LO2JHY2TNCM91BMQT Y29SB3I6CMDIKDI1NSWYNTUSMJU1KSI+R09FUY0XNG0KICAGICAGICAGICAGTWVZBY0YIDXZ CGFUIGNSYXNZPSJNBWFPBC1PBCI+U291BMRPBMC8L3NWYW4+IHBYB2R1Y3RZDQOGICAGICAG ICAGICAOTGVNYWN5IFZLCNRPY2FSIFRLBXBLCMF0DXJLLCBMZWDHY3KGVMVYDGLJYWWGTW9P C3R1CMUSDQOGICAGICAGICAGICBUB3RHBCBQCMVJAXBPDGFIBGUGV2F0ZXIPIGFUZCB0AGVP CIBKAXN0CMLIDXRPB24GDG8GUERBLJWVC3BHBJ48L2RPDJ4NCIAGICAGICAGPGRPDIBZDHLS ZT0IZM9UDDO0MDAGMTMUMZNWEC8XOS45OXB4DQPBCMLHBCXIZWX2ZXRPY2ESC2FUCY1ZZXJP ZJT0ZXH0LWFSAWDUOMXLZNQ7Y29SB3I6CMDIKDM0LDM0LDM0KTT0ZXH0LXRYYW5ZZM9YBTPU B25LO3RLEHQTAW5KZW50OJBWEDTSZXR0ZXITC3BHY2LUZZPUB3JTYWW7B3ZLCMZSB3C6DMLZ AWJSZTT0ZXH0LWRLY29YYXRPB246BM9UZTT3B3JKLXNWYWNPBMC6MHB4O3DOAXRLLXNWYWNL OM5VCM1HBDTMB250LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCU7YMFJA2DY B3VUZC1JB2XVCJP0CMFUC3BHCMVUDCI+PGJYDQPZDHLSZT0IBGLUZS1OZWLNAHQ6MTKUOTLW EDTVDMVYZMXVDZP2AXNPYMXLO2ZVBNQTC2L6ZTOXMY4ZM3B4O2ZVBNQTC3R5BGU6BM9YBWFS O2ZVBNQTDMFYAWFUDDPUB3JTYWW7ZM9UDC13ZWLNAHQ6NDAWO2ZVBNQTC2L6ZS1HZGP1C3Q6 BM9UZTTMB250LXN0CMV0Y2G6MTAWJSI+DQOGICAGICAGICAGPHN0CM9UZW0KC3R5BGU9IMXP BMUTAGVPZ2H0OJE5LJK5CHG7B3ZLCMZSB3C6DMLZAWJSZTTMB250LXNPEMU6MTMUMZNWEDTM B250LXN0EWXLOM5VCM1HBDTMB250LXZHCMLHBNQ6BM9YBWFSO2ZVBNQTD2VPZ2H0OJCWMDTM B250LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCUIPKRHDGUVVGLTZQ0KICAG ICAGICAGICAGB2YGSW5PDGLHBCBJBXBHY3Q6IDWVC3RYB25NPKP1BMUGMTI8C3BHBG0KY2XH C3M9IMDTYWLSLW1FLTQ2MDEYNTU0NJQ2MZK4NZC1MDLNBWFPBC1TXY0YNZI0ODE1MZIZMTG2 NTU1MJHNBWFPBC1TXY04OTUXODE0MTK4MDC1NDMZNTG4Z21HAWWTBV8TMZUZNZCYMJQXMZI4 NZAXNDIYOGDTYWLSLW1FMTM2NZCYNJK1NJY4NTQ1ODQ2OWDTYWLSLW1FNTMXNZY2MDQ5MTEY MTAWOTU4OWDTYWLSLW1FNJGYNZK4NDE5OTQ1MDAWNJAZZ21HAWWTBV80MZE0OTK3MDK5NDEW NTQ2NTM2Z21HAWWTBV8ZNZYYMTY1NZI1OTE4MDK2MZI5Z21HAWWTBV80MDCXMZY1NTMYNTYZ MTC1MJU5Z21HAWWTBV8TODI2MDK2OTAWNZQ5NTE4ODIWN2DTYWLSLW1FLTUWMZE5MDG1NZQ3 NTYXMZK3NWDTYWLSLW1FLTEZMTKWNDE5MDUZNJA4NJU0MDHNBWFPBC1TXZG3OTC3NTK3NTM3 NZQ3NZY5Z21HAWWTBV81MTUXODI2MDKXMJYYNDU1NDE5Z21HAWWTBV8ZNJU2OTEZMTUWODY1 OTY4ODZNBWFPBC1TXZEZNZQ3ODIXOTG5MTQ0MTC2MJZNBWFPBC1TXZC5NDEXOTG2NZGXMJCZ MTI4MJRNBWFPBC1TXZQYMTM2OTAZNTAXNDIYNJQ5OTDNBWFPBC1TXZQ4MJIXMTU5NDAZMZU2 ODI1ODBNBWFPBC1TXZC0NTQ4MTA3MDK5MJUZOTE4OTDNBWFPBC1TXY01ODM3MZQ1MDC4NDK1 NTU4MJGZZ21HAWWTBV8TODY5NDE1ODK5OTUWOTE2MTY4NGDTYWLSLW1FNTC2MJKWMDC5MJCW NJG3MZM5NGDTYWLSLW1FNTQWOTGXMTI1ODIYNDYWNJMYOGDTYWLSLW1FMTGWNJE0MTM3MZK4 MDY4MDAWMGDTYWLSLW1FMJQZMDAXNZEXNJG0OTYYNTAXOGDTYWLSLW1FODQYNJQXNZAZOTE2 NJQ3MJC4NGDTYWLSLW1FNTYWNJM5MTY3MTAYMJG2NJQ5Z21HAWWTBV8TMTGWNDY4ODY1MZY3 MJC5NJC5OGDTYWLSLW1FLTQWNTA3ODY2NTAWOTYXMTI1NTRNBWFPBC1TXY0YMZEWOTC5OTAY ODM0NZM2NZQZZ21HAWWTBV81NTY2NDC0NTA5MDY2MTQ4NJMZZ21HAWWTBV8TMJKWOTYZMZKW MJG5MZC4NTI2NWDTYWLSLW1FNZM5MTA2NDC0MTE4OTE2NDAZMWDTYWLSLW1FLTCZMZA0ODM5 NZCWMJUXMZG5MMDTYWLSLW1FLTU5ODKZMJC0NDA4NJC4NZI3NDBNBWFPBC1TXY00MDUYMDM5 NJE5NDK5MTG5MJUYZ21HAWWTBV85ODYXMDMYMZMYMTQXNZI3NJNNBWFPBC1TXZGWMTQWOTM4 MTGXNJUXNDE1Z21HAWWTBV84MDQZMTM2NDYWNDYWNDAZNZDNBWFPBC1TXY03NDY1NDI0NTK1 NZY4MZI2MJQ4Z21HAWWTBV8TNZA5NTK2ODK2NDQZODG3MTI0NMDTYWLSLWFCBIINCNN0EWXL PSJSAW5LLWHLAWDODDOXOS45OXB4O292ZXJMBG93ONZPC2LIBGU7ZM9UDC1ZAXPLOJEZLJMZ CHG7ZM9UDC1ZDHLSZTPUB3JTYWW7ZM9UDC12YXJPYW50OM5VCM1HBDTMB250LXDLAWDODDO0 MDA7ZM9UDC1ZAXPLLWFKANVZDDPUB25LO2ZVBNQTC3RYZXRJADOXMDALIJ48C3BHBG0KY2XH C3M9IMDTYWLSLW1FLTQ2MDEYNTU0NJQ2MZK4NZC1MDLNBWFPBC1TXY0YNZI0ODE1MZIZMTG2 NTU1MJHNBWFPBC1TXY04OTUXODE0MTK4MDC1NDMZNTG4Z21HAWWTBV8TMZUZNZCYMJQXMZI4 NZAXNDIYOGDTYWLSLW1FMTM2NZCYNJK1NJY4NTQ1ODQ2OWDTYWLSLW1FNTMXNZY2MDQ5MTEY MTAWOTU4OWDTYWLSLW1FNJGYNZK4NDE5OTQ1MDAWNJAZZ21HAWWTBV80MZE0OTK3MDK5NDEW NTQ2NTM2Z21HAWWTBV8ZNZYYMTY1NZI1OTE4MDK2MZI5Z21HAWWTBV80MDCXMZY1NTMYNTYZ MTC1MJU5Z21HAWWTBV8TODI2MDK2OTAWNZQ5NTE4ODIWN2DTYWLSLW1FLTUWMZE5MDG1NZQ3 NTYXMZK3NWDTYWLSLW1FLTEZMTKWNDE5MDUZNJA4NJU0MDHNBWFPBC1TXZG3OTC3NTK3NTM3 NZQ3NZY5Z21HAWWTBV81MTUXODI2MDKXMJYYNDU1NDE5Z21HAWWTBV8ZNJU2OTEZMTUWODY1 OTY4ODZNBWFPBC1TXZEZNZQ3ODIXOTG5MTQ0MTC2MJZNBWFPBC1TXZC5NDEXOTG2NZGXMJCZ MTI4MJRNBWFPBC1TXZQYMTM2OTAZNTAXNDIYNJQ5OTDNBWFPBC1TXZQ4MJIXMTU5NDAZMZU2 ODI1ODBNBWFPBC1TXZC0NTQ4MTA3MDK5MJUZOTE4OTDNBWFPBC1TXY01ODM3MZQ1MDC4NDK1 NTU4MJGZZ21HAWWTBV8TODY5NDE1ODK5OTUWOTE2MTY4NGDTYWLSLW1FNTC2MJKWMDC5MJCW NJG3MZM5NGDTYWLSLW1FNTQWOTGXMTI1ODIYNDYWNJMYOGDTYWLSLW1FMTGWNJE0MTM3MZK4 MDY4MDAWMGDTYWLSLW1FMJQZMDAXNZEXNJG0OTYYNTAXOGDTYWLSLW1FODQYNJQXNZAZOTE2 NJQ3MJC4NGDTYWLSLW1FNTYWNJM5MTY3MTAYMJG2NJQ5Z21HAWWTBV8TMTGWNDY4ODY1MZY3 MJC5NJC5OGDTYWLSLW1FLTQWNTA3ODY2NTAWOTYXMTI1NTRNBWFPBC1TXY0YMZEWOTC5OTAY ODM0NZM2NZQZZ21HAWWTBV81NTY2NDC0NTA5MDY2MTQ4NJMZZ21HAWWTBV8TMJKWOTYZMZKW MJG5MZC4NTI2NWDTYWLSLW1FNZM5MTA2NDC0MTE4OTE2NDAZMWDTYWLSLW1FLTCZMZA0ODM5 NZCWMJUXMZG5MMDTYWLSLW1FLTU5ODKZMJC0NDA4NJC4NZI3NDBNBWFPBC1TXY00MDUYMDM5 NJE5NDK5MTG5MJUYZ21HAWWTBV85ODYXMDMYMZMYMTQXNZI3NJNNBWFPBC1TXZGWMTQWOTM4 MTGXNJUXNDE1Z21HAWWTBV84MDQZMTM2NDYWNDYWNDAZNZDNBWFPBC1TXY03NDY1NDI0NTK1 NZY4MZI2MJQ4Z21HAWWTBV8TNZA5NTK2ODK2NDQZODG3MTI0NMDTYWLSLWFRSIINCNN0EWXL PSJSAW5LLWHLAWDODDOXOS45OXB4O292ZXJMBG93ONZPC2LIBGU7ZM9UDC1ZAXPLOJEZLJMZ CHG7ZM9UDC1ZDHLSZTPUB3JTYWW7ZM9UDC12YXJPYW50OM5VCM1HBDTMB250LXDLAWDODDO0 MDA7ZM9UDC1ZAXPLLWFKANVZDDPUB25LO2ZVBNQTC3RYZXRJADOXMDALIJ4SDQOGICAGICAG ICAGICAGIDIWMTKGMJEXNVO8L3NWYW4+PC9ZCGFUPJXICG0KC3R5BGU9IMXPBMUTAGVPZ2H0 OJE5LJK5CHG7B3ZLCMZSB3C6DMLZAWJSZTTMB250LXNPEMU6MTMUMZNWEDTMB250LXN0EWXL OM5VCM1HBDTMB250LXZHCMLHBNQ6BM9YBWFSO2ZVBNQTD2VPZ2H0OJQWMDTMB250LXNPEMUT YWRQDXN0OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCUIPG0KICAGICAGICAGIDXICG0KC3R5BGU9 IMXPBMUTAGVPZ2H0OJE5LJK5CHG7B3ZLCMZSB3C6DMLZAWJSZTTMB250LXNPEMU6MTMUMZNW EDTMB250LXN0EWXLOM5VCM1HBDTMB250LXZHCMLHBNQ6BM9YBWFSO2ZVBNQTD2VPZ2H0OJQW MDTMB250LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCUIPG0KICAGICAGICAG IDXIPKRHDGUVVGLTZSBVZIBFEHBLY3RLZCBFBMQ6PC9IPIBUQKQ8YNINCNN0EWXLPSJSAW5L LWHLAWDODDOXOS45OXB4O292ZXJMBG93ONZPC2LIBGU7ZM9UDC1ZAXPLOJEZLJMZCHG7ZM9U DC1ZDHLSZTPUB3JTYWW7ZM9UDC12YXJPYW50OM5VCM1HBDTMB250LXDLAWDODDO0MDA7ZM9U DC1ZAXPLLWFKANVZDDPUB25LO2ZVBNQTC3RYZXRJADOXMDALIJ4NCIAGICAGICAGICA8YNIN CNN0EWXLPSJSAW5LLWHLAWDODDOXOS45OXB4O292ZXJMBG93ONZPC2LIBGU7ZM9UDC1ZAXPL OJEZLJMZCHG7ZM9UDC1ZDHLSZTPUB3JTYWW7ZM9UDC12YXJPYW50OM5VCM1HBDTMB250LXDL AWDODDO0MDA7ZM9UDC1ZAXPLLWFKANVZDDPUB25LO2ZVBNQTC3RYZXRJADOXMDALIJ4NCIAG ICAGICAGICA8YJ5MZW5NDGGGB2YGRXZLBNQ6PC9IPIBUQKTCODXICG0KC3R5BGU9IMXPBMUT AGVPZ2H0OJE5LJK5CHG7B3ZLCMZSB3C6DMLZAWJSZTTMB250LXNPEMU6MTMUMZNWEDTMB250 LXN0EWXLOM5VCM1HBDTMB250LXZHCMLHBNQ6BM9YBWFSO2ZVBNQTD2VPZ2H0OJQWMDTMB250 LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCUIPG0KICAGICAGICAGIDXICG0K C3R5BGU9IMXPBMUTAGVPZ2H0OJE5LJK5CHG7B3ZLCMZSB3C6DMLZAWJSZTTMB250LXNPEMU6 MTMUMZNWEDTMB250LXN0EWXLOM5VCM1HBDTMB250LXZHCMLHBNQ6BM9YBWFSO2ZVBNQTD2VP Z2H0OJQWMDTMB250LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCUIPG0KICAG ICAGICAGIDXIPKRLDGFPBHMVU3BLY2LMAWNZIG9MIENOYW5NZTO8L2I+WQAGPHNWYW4NCNN0 EWXLPSJ0ZXH0LWFSAWDUOMXLZNQ7Y29SB3I6CMDIKDM0LDM0LDM0KTT0ZXH0LXRYYW5ZZM9Y BTPUB25LO2XPBMUTAGVPZ2H0OJE5LJK5CHG7DGV4DC1PBMRLBNQ6MHB4O2XLDHRLCI1ZCGFJ AW5NOM5VCM1HBDTMB250LXNPEMU6MTMUMZNWEDTMB250LXN0EWXLOM5VCM1HBDTMB250LXZH CMLHBNQ6BM9YBWFSO2ZVBNQTD2VPZ2H0OJQWMDT0ZXH0LWRLY29YYXRPB246BM9UZTT3B3JK LXNWYWNPBMC6MHB4O2RPC3BSYXK6AW5SAW5LO3DOAXRLLXNWYWNLOM5VCM1HBDTMB250LXNP EMUTYWRQDXN0OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCU7ZMXVYXQ6BM9UZTTIYWNRZ3JVDW5K LWNVBG9YONJNYIGYNTUSMJU1LDI1NSKIPKLUDGVYBWL0DGVUDA0KICAGICAGICAGICAGZGVN CMFKYXRPB24GB2BCODWVC3BHBJ48C3BHBG0KC3R5BGU9INRLEHQTYWXPZ246BGVMDDTJB2XV CJPYZ2IOMZQSMZQSMZQPO3RLEHQTDHJHBNNMB3JTOM5VBMU7BGLUZS1OZWLNAHQ6MTKUOTLW EDT0ZXH0LWLUZGVUDDOWCHG7BGV0DGVYLXNWYWNPBMC6BM9YBWFSO2ZVBNQTC2L6ZTOXMY4Z M3B4O2ZVBNQTC3R5BGU6BM9YBWFSO2ZVBNQTDMFYAWFUDDPUB3JTYWW7ZM9UDC13ZWLNAHQ6 NDAWO3RLEHQTZGVJB3JHDGLVBJPUB25LO3DVCMQTC3BHY2LUZZOWCHG7ZGLZCGXHETPPBMXP BMU7D2HPDGUTC3BHY2U6BM9YBWFSO2ZVBNQTC2L6ZS1HZGP1C3Q6BM9UZTTMB250LXN0CMV0 Y2G6MTAWJTTMBG9HDDPUB25LO2JHY2TNCM91BMQTY29SB3I6CMDIKDI1NSWYNTUSMJU1KSI+ R09FUY0XNG0KICAGICAGICAGICAGTWVZBY0YIDXZCGFUIGNSYXNZPSJNBWFPBC1PBCI+U291 BMRPBMC8L3NWYW4+IHBYB2R1Y3RZDQOGICAGICAGICAGICAOTGVNYWN5IFZLCNRPY2FSIFRL BXBLCMF0DXJLLCBMZWDHY3KGVMVYDGLJYWWGTW9PC3R1CMUSDQOGICAGICAGICAGICBUB3RH BCBQCMVJAXBPDGFIBGUGV2F0ZXIPIGFUZCB0AGVPCIBKAXN0CMLIDXRPB24GDG8GUERBIGR1 ZQ0KICAGICAGICAGICAGDG8GYW4GYW5VBWFSES48L3NWYW4+WQDCODXZDHJVBMCNCNN0EWXL PSJSAW5LLWHLAWDODDOXOS45OXB4O292ZXJMBG93ONZPC2LIBGU7ZM9UDC1ZAXPLOJEZLJMZ CHG7ZM9UDC1ZDHLSZTPUB3JTYWW7ZM9UDC12YXJPYW50OM5VCM1HBDTMB250LXDLAWDODDO3 MDA7ZM9UDC1ZAXPLLWFKANVZDDPUB25LO2ZVBNQTC3RYZXRJADOXMDALIJ7COMKGPC9ZDHJV BMC+WQDCOMKGDQOGICAGICAGICAGPHN0CM9UZW0KC3R5BGU9IMXPBMUTAGVPZ2H0OJE5LJK5 CHG7B3ZLCMZSB3C6DMLZAWJSZTTMB250LXNPEMU6MTMUMZNWEDTMB250LXN0EWXLOM5VCM1H BDTMB250LXZHCMLHBNQ6BM9YBWFSO2ZVBNQTD2VPZ2H0OJCWMDTMB250LXNPEMUTYWRQDXN0 OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCUIPSKGPC9ZDHJVBMC+PC9KAXY+DQOGICAGICAGIDXK AXYGC3R5BGU9IMZVBNQ6NDAWIDEZLJMZCHGVMTKUOTLWEA0KQXJPYWWSSGVSDMV0AWNHLHNH BNMTC2VYAWY7DGV4DC1HBGLNBJPSZWZ0O2NVBG9YONJNYIGZNCWZNCWZNCK7DGV4DC10CMFU C2ZVCM06BM9UZTT0ZXH0LWLUZGVUDDOWCHG7BGV0DGVYLXNWYWNPBMC6BM9YBWFSO292ZXJM BG93ONZPC2LIBGU7DGV4DC1KZWNVCMF0AW9UOM5VBMU7D29YZC1ZCGFJAW5NOJBWEDT3AGL0 ZS1ZCGFJZTPUB3JTYWW7ZM9UDC1ZAXPLLWFKANVZDDPUB25LO2ZVBNQTC3RYZXRJADOXMDAL O2JHY2TNCM91BMQTY29SB3I6DHJHBNNWYXJLBNQIPSKGWQDCOMKGWQA8YNINCNN0EWXLPSJS AW5LLWHLAWDODDOXOS45OXB4O292ZXJMBG93ONZPC2LIBGU7ZM9UDC1ZAXPLOJEZLJMZCHG7 ZM9UDC1ZDHLSZTPUB3JTYWW7ZM9UDC12YXJPYW50OM5VCM1HBDTMB250LXDLAWDODDO0MDA7 ZM9UDC1ZAXPLLWFKANVZDDPUB25LO2ZVBNQTC3RYZXRJADOXMDALIJ4NCIAGICAGICAGICA8 YG0KC3R5BGU9IMXPBMUTAGVPZ2H0OJE5LJK5CHG7B3ZLCMZSB3C6DMLZAWJSZTTMB250LXNP EMU6MTMUMZNWEDTMB250LXN0EWXLOM5VCM1HBDTMB250LXZHCMLHBNQ6BM9YBWFSO2ZVBNQT D2VPZ2H0OJCWMDTMB250LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCUIPKNV BNRHY3QNCIAGICAGICAGICAGIELUZM9YBWF0AW9UIGZVCIBGDXJ0AGVYIELUZM9YBWF0AW9U OIA8L2I+PGENCIAGICAGICAGICAGIHN0EWXLPSJJB2XVCJPYZ2IOMTCSODUSMJA0KSIGAHJL ZJ0IBWFPBHRVONJVC3MUY294QG5VYWEUZ292IG0KICAGICAGICAGICAGDGFYZ2V0PSJFYMXH BMSIIG1VEI1KBY1UB3QTC2VUZD0IDHJ1ZSI+PHNWYW4NCMLKPSJNBWFPBC1TXY00NJAXMJU1 NDY0NJM5ODC3NTA5Z21HAWWTBV8TMJCYNDGXNTMYMZE4NJU1NTI4Z21HAWWTBV8TODK1MTGX NDE5ODA3NTQZMZU4OGDTYWLSLW1FLTM1MZC3MJI0MTMYODCWMTQYMJHNBWFPBC1TXZEZNJC3 MJY5NTY2ODU0NTG0NJLNBWFPBC1TXZUZMTC2NJA0OTEXMJEWMDK1ODLNBWFPBC1TXZY4MJC5 ODQXOTK0NTAWMDYWM2DTYWLSLW1FNDMXNDK5NZA5OTQXMDU0NJUZNMDTYWLSLW1FMZC2MJE2 NTCYNTKXODA5NJMYOWDTYWLSLW1FNDA3MTM2NTUZMJU2MZE3NTI1OWDTYWLSLW1FLTGYNJA5 NJKWMDC0OTUXODGYMDDNBWFPBC1TXY01MDMXOTA4NTC0NZU2MTM5NZU6MWFQLJQIDQOGICAG ICAGICAGICAGIHN0EWXLPSJJB2XVCJPYZ2IOMTCSODUSMJA0KSI+CM9ZCZWVC3BHBJ4UY294 QDXZCGFUDQPPZD0IZ21HAWWTBV8TNDYWMTI1NTQ2NDYZOTG3NZUWOWDTYWLSLW1FLTI3MJQ4 MTUZMJMXODY1NTUYOGDTYWLSLW1FLTG5NTE4MTQXOTGWNZU0MZM1ODHNBWFPBC1TXY0ZNTM3 NZIYNDEZMJG3MDE0MJI4Z21HAWWTBV8XMZY3NZI2OTU2NJG1NDU4NDY5Z21HAWWTBV81MZE3 NJYWNDKXMTIXMDA5NTG5Z21HAWWTBV82ODI3OTG0MTK5NDUWMDA2MDNNBWFPBC1TXZQZMTQ5 OTCWOTK0MTA1NDY1MZZNBWFPBC1TXZM3NJIXNJU3MJU5MTGWOTYZMJLNBWFPBC1TXZQWNZEZ NJU1MZI1NJMXNZUYNTLNBWFPBC1TXY04MJYWOTY5MDA3NDK1MTG4MJA3Z21HAWWTBV8TNTAZ MTKWODU3NDC1NJEZOTC1OJFHAI41IG0KICAGICAGICAGICAGICBZDHLSZT0IY29SB3I6CMDI KDE3LDG1LDIWNCKIPM5VYWE8L3NWYW4+LMDVDJWVYT48L2RPDJ4NCIAGICAGICAGPGRPDIBZ DHLSZT0IZM9UDDO0MDAGMTMUMZNWEC8XOS45OXB4DQPBCMLHBCXIZWX2ZXRPY2ESC2FUCY1Z ZXJPZJT0ZXH0LWFSAWDUOMXLZNQ7Y29SB3I6CMDIKDM0LDM0LDM0KTT0ZXH0LXRYYW5ZZM9Y BTPUB25LO3RLEHQTAW5KZW50OJBWEDTSZXR0ZXITC3BHY2LUZZPUB3JTYWW7B3ZLCMZSB3C6 DMLZAWJSZTT0ZXH0LWRLY29YYXRPB246BM9UZTT3B3JKLXNWYWNPBMC6MHB4O3DOAXRLLXNW YWNLOM5VCM1HBDTMB250LXNPEMUTYWRQDXN0OM5VBMU7ZM9UDC1ZDHJLDGNOOJEWMCU7YMFJ A2DYB3VUZC1JB2XVCJP0CMFUC3BHCMVUDCI+DQOGICAGICAGICAGPHAGY2XHC3M9IK1ZB05V CM1HBCI+PGI+V2VIIFNPDGUOCYKGZM9YIGFWCGXPY2FIBGUNCIAGICAGICAGICAGICAGAW5M B3JTYXRPB246PC9IPJXZCGFUPIBOL0EGPGJYPG0KICAGICAGICAGICAGPC9ZCGFUPJWVCD4N CIAGICAGICAGICA8CCBJBGFZCZ0ITXNVTM9YBWFSIJ48C3BHBJ48L3NWYW4+IFROAXMGBWVZ C2FNZSB3YXMGC2VUDCBMCM9TDQOGICAGICAGICAGICA8YQ0KY2XHC3M9IMDTYWLSLW1FLTU1 MTU5MZE4MJM3NDG3ODKZODHTXZIYNDI1ODY4MDA1NTQXODAYNTBNBWFPBC1TXZKWMZCZMZA0 MZU3NDE4NJEXOG1VEI10EHQTBGLUAY1HYMJYZXZPYXRLZCINCIAGICAGICAGICAGICAGAHJL ZJ0IBWFPBHRVOKVTUEMUTM90AWZPY2F0AW9UQG5VYWEUZ292IIB0YXJNZXQ9IL9IBGFUAYIN CIAGICAGICAGICAGICAGBW96LWRVLW5VDC1ZZW5KPSJ0CNVLIJ5FU1BDLK5VDGLMAWNHDGLV BKBUB2FHLMDVDJWVYT4UIFLVDQ0KICAGICAGICAGICAGAGF2ZSBIZWVUIHNLBNQGDGHPCYBH BMQGB3ROZXIGBM90AWZPY2F0AW9UCYBIZWNHDXNLIHLVDSBOYXZLDQOGICAGICAGICAGICBV CHRLZCBPBIB0BYBYZWNLAXZLIGL0LIBJZIBMB3IGYW55IHJLYXNVBIWGEW91IHDPC2GGDG8N CIAGICAGICAGICAGIHVUC3VIC2NYAWJLLCBWBGVHC2UGY29UDGFJDCBFU1BDIEHLBHAGRGVZ AYBHDCA8YQ0KY2XHC3M9IMDTYWLSLW1FLTU1MTU5MZE4MJM3NDG3ODKZODHTXZIYNDI1ODY4 MDA1NTQXODAYNTBNBWFPBC1TXZKWMZCZMZA0MZU3NDE4NJEXOG1VEI10EHQTBGLUAY1HYMJY ZXZPYXRLZCINCIAGICAGICAGICAGICAGAHJLZJ0IBWFPBHRVOKVTUENPCGVYYXRPB25ZQG5V YWEUZ292IIB0YXJNZXQ9IL9IBGFUAYINCIAGICAGICAGICAGICAGBW96LWRVLW5VDC1ZZW5K PSJ0CNVLIJ5FU1BDT3BLCMF0AW9UC0BUB2FHLMDVDJWVYT4GB3IGPGENCIAGICAGICAGICAG ICAGAHJLZJ0IDGVSOIUYODMWMSUYOSUYMDGXNY0ZODGWIIB2YWX1ZT0IKZEZMDE4MTCZODGW IG0KICAGICAGICAGICAGICB0YXJNZXQ9IL9IBGFUAYIGBW96LWRVLW5VDC1ZZW5KPSJ0CNVL IJ4OMZAXKSA4MTCTMZG4MDWVYT4UDQOGICAGICAGICAGICBQBGVHC2UGBM90ZTOGAXQGBWF5 IHRHA2UGDXAGDG8GDHDVIGJ1C2LUZXNZIGRHEXMGDG8GCHJVY2VZCW0KICAGICAGICAGICAG EW91CIB1BNN1YNNJCMLIZSBYZXF1ZXN0LJWVCD4NCIAGICAGICAGPC9KAXY+DQOGICAGICA8 L2RPDJ4NCIAGICA8L2RPDJ4NCIAGPC9IB2R5PG0KPC9ODG1SPG0K --BOUNDARY_(ID_VWLBVJ8JY4RBEIBJG4A20A)-- =  342 NOUS74 KMRX 131151 ADAMRX Routine Administrative Message (Urgent Notification) National Weather Service Morristown TN 800 AM EDT Thu Jun 13 2019 TO: MEG (Public Service) FM: MRX Morristown Morning Climate Data Yesterday's Max 72 12 Hour Min 62 24 Hour Pcpn 0.52 24 Hour Snowfall 0.0 Snow on the Ground 0 $$ 
 072 NOUS71 KNES 121805 ADANES SUBJECT: PRODUCT OUTAGE: GOES-16, GOES-17 ABI L2 PRODUCTS DELIVERED THIS IS A MULTI-PART MESSAGE IN MIME FORMAT. --BOUNDARY_(ID_THI4TVGP9/HB6TULNOJSRG) CONTENT-TYPE: TEXT/PLAIN; CHARSET=WINDOWS-1252; FORMAT=FLOWED CONTENT-TRANSFER-ENCODING: 8BIT *TOPIC*: DELIVERED TO PDA *DATE/TIME ISSUED*: *PRODUCT(S) OR DATA IMPACTED*: WINDS ALL CHANNELS ALL SCENE TYPES DELIVERED TO PDA *DATE/TIME OF INITIAL IMPACT:* *DATE/TIME OF EXPECTED END*: TBD *LENGTH OF EVENT:* TBD *DETAILS/SPECIFICS OF CHANGE*: WINDS ALL CHANNELS ALL SCENE TYPES DELIVERED TO PDA *CONTACT INFORMATION FOR FURTHER INFORMATION: * ESPCOPERATIONS@NOAA.GOV ROSS.COX@NOAA.GOV *WEB SITE(S) FOR APPLICABLE INFORMATION:* N/A . YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880 . PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST. --BOUNDARY_(ID_THI4TVGP9/HB6TULNOJSRG) CONTENT-TYPE: TEXT/HTML; CHARSET=WINDOWS-1252 CONTENT-TRANSFER-ENCODING: 8BIT

TOPIC: CHANNELS DELIVERED TO PDA

DATE/TIME ISSUED:
PRODUCT(S) OR DATA IMPACTED: DERIVED MOTION WINDS ALL CHANNELS ALL SCENE TYPES DELIVERED TO PDA

DATE/TIME OF INITIAL IMPACT:
DATE/TIME OF EXPECTED END: TBD

LENGTH OF EVENT: TBD

DETAILS/SPECIFICS OF CHANGE: DERIVED MOTION WINDS ALL CHANNELS ALL SCENE TYPES DELIVERED TO PDA

CONTACT INFORMATION FOR FURTHER INFORMATION:
ESPCOPERATIONS@NOAA.GOV
ROSS.COX@NOAA.GOV

WEB SITE(S) FOR APPLICABLE INFORMATION: N/A

CLASS="GMAIL-M_-5515931823748789388M_2242586800554180250GMAIL-M_903733043574186118MOZ-TXT-LINK-ABBREVIATED" HREF="MAILTO:ESPC.NOTIFICATION@NOAA.GOV" TARGET="_BLANK" MOZ-DO-NOT-SEND="TRUE">ESPC.NOTIFICATION@NOAA.GOV. YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880. PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST.


--BOUNDARY_(ID_THI4TVGP9/HB6TULNOJSRG)-- = 
 565 NOUS74 KEHU 121733 ADASRH Alert Administrative Message National Weather Service Southern Region Headquarters 1233 PM CDT Wed Jun 12 2019 TO: All Southern Region Offices FROM: WFO LCH SUBJECT: WFO LCH has completed Service Backup for WFO BRO WFO LCH has ended full service backup for WFO BRO. WFO BRO has completed their planned AWIPS upgrade. $$ 06 
 585 NOUS74 KEHU 121326 ADASRH Alert Administrative Message National Weather Service Southern Region Headquarters 826 AM CDT Wed Jun 12 2019 TO: All Southern Region Offices FROM: WFO LCH SUBJECT: WFO LCH is providing Service Backup for WFO BRO WFO LCH has assumed full service backup for WFO BRO due to an AWIPS upgrade. $$ 06 
 842 NOUS71 KNES 120946 ADANES SUBJECT: PRODUCT OUTAGE/ANOMALY: DMSP F-15 DATA LOSS - ISSUED: JUNE 12, THIS IS A MULTI-PART MESSAGE IN MIME FORMAT. --BOUNDARY_(ID_GUYV30CCJJ6LPUY5JSSN9A) CONTENT-TYPE: TEXT/PLAIN; CHARSET=WINDOWS-1252; FORMAT=FLOWED CONTENT-TRANSFER-ENCODING: 8BIT *TOPIC:*DMSP F-15 DATA LOSS *DATE/TIME ISSUED:* ** *PRODUCT(S) OR DATA IMPACTED: *F-15 REV. 00789 *DATE/TIME OF INITIAL IMPACT: *JUNE 12, 2019 0609Z *DATE/TIME OF EXPECTED END: *N/A** *LENGTH OF OUTAGE:*N/A *DETAILS/SPECIFICS OF CHANGE:*ESPC HAS NOT RECEIVED THE DMSP F-15 REV. 00789 FROM FNMOC/ MONTEREY. RESHIP DATA WAS RECEIVED THERE, IT WAS NOT RECEIVED AT NSOF. *CONTACT INFORMATION FOR FURTHER INFORMATION:* ESPCOPERATIONS@NOAA.GOV AT 301-817-3880 ** *WEB SITE(S) FOR APPLICABLE INFORMATION:* THIS MESSAGE WAS SENT BY ESPC.NOTIFICATION@NOAA.GOV . YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880 . PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST. _ --BOUNDARY_(ID_GUYV30CCJJ6LPUY5JSSN9A) CONTENT-TYPE: TEXT/HTML; CHARSET=WINDOWS-1252 CONTENT-TRANSFER-ENCODING: 8BIT

TOPIC: STYLE="FONT-SIZE:12.0PT;FONT-FAMILY:"TIMES NEW ROMAN","SERIF";MSO-FAREAST-FONT-FAMILY: "TIMES NEW ROMAN"">DMSP F-15 DATA LOSS

DATE/TIME ISSUED: JUNE 12, 2019 0930Z


PRODUCT(S) OR DATA IMPACTED: STYLE="FONT-SIZE:12.0PT;FONT-FAMILY:"TIMES NEW ROMAN","SERIF"; MSO-FAREAST-FONT-FAMILY:"TIMES NEW ROMAN"">F-15 REV. 00789

DATE/TIME OF INITIAL IMPACT: STYLE="FONT-SIZE:12.0PT;FONT-FAMILY:"TIMES NEW ROMAN","SERIF"; MSO-FAREAST-FONT-FAMILY:"TIMES NEW ROMAN"">JUNE 12, 2019 0609Z

DATE/TIME OF EXPECTED END: N/A

LENGTH OF OUTAGE: N/A

DETAILS/SPECIFICS OF CHANGE: ESPC HAS NOT RECEIVED THE DMSP F-15 REV. 00789 FROM FNMOC/ MONTEREY. AFTER THE RESHIP DATA WAS RECEIVED THERE, IT WAS NOT RECEIVED AT NSOF. STYLE="FONT-SIZE:12.0PT;FONT-FAMILY:"TIMES NEW ROMAN","SERIF";MSO-FAREAST-FONT-FAMILY: "TIMES NEW ROMAN"">


CONTACT INFORMATION FOR FURTHER INFORMATION: HREF="MAILTO:ESPCOPERATIONS@NOAA.GOV" MOZ-DO-NOT-SEND="TRUE">ESPCOPERATIONS@NOAA.GOV AT 301-817-3880


WEB SITE(S) FOR APPLICABLE INFORMATION: N/A

THIS MESSAGE WAS SENT BY TARGET="_BLANK" MOZ-DO-NOT-SEND="TRUE">ESPC.NOTIFICATION@NOAA.GOV. YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF FOR ANY REASON, YOU WISH TO UNSUBSCRIBE, PLEASE CONTACT ESPC HELP DESK AT MOZ-DO-NOT-SEND="TRUE">ESPCOPERATIONS@NOAA.GOVOR HREF="TEL:%28301%29%20817-3880" TARGET="_BLANK" MOZ-DO-NOT-SEND="TRUE">(301) 817-3880. PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST.

--BOUNDARY_(ID_GUYV30CCJJ6LPUY5JSSN9A)-- = 
 018 NOUS71 KNES 111426 ADANES SUBJECT: PRODUCT OUTAGE/ANOMALY: NDE PARTIAL SNPP PRODUCT OUTAGE - THIS IS A MULTI-PART MESSAGE IN MIME FORMAT. --BOUNDARY_(ID_SCIC5+RNYLRTRQXHKKJNEG) CONTENT-TYPE: TEXT/PLAIN; CHARSET=UTF-8; FORMAT=FLOWED CONTENT-TRANSFER-ENCODING: 8BIT *TOPIC:*NDE PARTIAL SNPP PRODUCT OUTAGE *DATE/TIME ISSUED: *JUNE 11, 2019, 1420Z *PRODUCT(S) OR DATA IMPACTED:* RESTRICTED TO SNPP PRODUCTS ONLY. *DATE/TIME OF INITIAL IMPACT:* JUNE 10, 2019, 1530Z *DATE/TIME OF EXPECTED END:* JUNE 11, 2019, 1230Z *LENGTH OF OUTAGE:*21 HRS *DETAILS/SPECIFICS OF CHANGE: * NDE STOPPED GENERATING SOME PRODUCTS FROM 06/10/2019 AT ~1530Z TO 6/11/2019 AT ~1230Z ENGINEERS HAVE IDENTIFIED AND CORRECTED THE PROBLEM. NDE IS NOW BEGINNING TO GENERATE THE MOST RECENT PRODUCTS. ALL THE MISSING PRODUCTS ARE BEING RECOVERED IN THE NEXT COUPLE OF HOURS. SOME DATA WILL NOT BE TRANSFERRED TO USERS BECAUSE IT WILL NOT MEET THEIR TIMELINESS REQUIREMENTS. *CONTACT INFORMATION:* FOR INFORMATION ON THE STATUS OF THIS WORK, PLEASE CONTACT ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AND 301-817-3880 THIS MESSAGE WAS SENT TO ESPC.NOTIFICATION@NOAA.GOV . YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF YOU WISH TO UNSUBSCRIBE PLEASE CONTACT THE ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880 . PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST. --BOUNDARY_(ID_SCIC5+RNYLRTRQXHKKJNEG) CONTENT-TYPE: TEXT/HTML; CHARSET=UTF-8 CONTENT-TRANSFER-ENCODING: 8BIT

TOPIC: NDE PARTIAL SNPP PRODUCT OUTAGE

DATE/TIME ISSUED: JUNE 11, 2019, 1420Z

PRODUCT(S) OR DATA IMPACTED: RESTRICTED TO SNPP PRODUCTS ONLY.

DATE/TIME OF INITIAL IMPACT: JUNE 10, 2019, 1530Z

DATE/TIME OF EXPECTED END: JUNE 11, 2019, 1230Z

LENGTH OF OUTAGE: 21 HRS

DETAILS/SPECIFICS OF CHANGE: NDE STOPPED GENERATING SOME PRODUCTS FROM 06/10/2019 AT ~1530Z TO 6/11/2019 AT ~1230Z ENGINEERS HAVE IDENTIFIED AND CORRECTED THE PROBLEM. NDE IS NOW BEGINNING TO GENERATE THE MOST RECENT PRODUCTS. ALL THE MISSING PRODUCTS ARE BEING RECOVERED IN THE NEXT COUPLE OF HOURS. SOME DATA WILL NOT BE TRANSFERRED TO USERS BECAUSE IT WILL NOT MEET THEIR TIMELINESS REQUIREMENTS.

CONTACT INFORMATION: FOR INFORMATION ON THE STATUS OF THIS WORK, PLEASE CONTACT ESPC OPERATIONS AT ESPCOPERATIONS@NOAA.GOV AND 301-817-3880

THIS MESSAGE WAS SENT TO ESPC.NOTIFICATION@NOAA.GOV. YOU HAVE BEEN SENT THIS AND OTHER NOTIFICATIONS BECAUSE YOU HAVE OPTED IN TO RECEIVE IT. IF YOU WISH TO UNSUBSCRIBE PLEASE CONTACT THE ESPC HELP DESK AT ESPCOPERATIONS@NOAA.GOV OR (301) 817-3880. PLEASE NOTE: IT MAY TAKE UP TO TWO BUSINESS DAYS TO PROCESS YOUR UNSUBSCRIBE REQUEST.

--BOUNDARY_(ID_SCIC5+RNYLRTRQXHKKJNEG)-- = 
 183 NOUS74 KMRX 092358 ADAMRX Routine Administrative Message (Urgent Notification) National Weather Service Morristown TN 800 PM EDT Sun Jun 9 2019 TO: MEG (Public Service) FM: MRX Morristown Evening Climate Data 18 Hour Max 84 18 Hour Min 68 24 Hour Pcpn Trace 24 Hour Snowfall 0.0 Snow on the Ground 0 $$ 
Page Loaded at: 2019-06-16 12:16:32 -- Client Address: 54.209.227.199 -- Load Time: 0.3855 seconds